KEGG   Homo sapiens (human): 3394Help
Entry
3394              CDS       T01001                                 

Gene name
IRF8, H-ICSBP, ICSBP, ICSBP1, IRF-8
Definition
interferon regulatory factor 8
Orthology
K10155  
interferon regulatory factor 8
Organism
hsa  Homo sapiens (human)
Pathway
Pertussis
Class
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.1
AA seq 426 aa AA seqDB search
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQ
QPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTK
LYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCS
GNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPL
RSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE
NQQITV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaccggaatggtggtcggcggcttcgacagtggctgatcgagcagattgacagt
agcatgtatccaggactgatttgggagaatgaggagaagagcatgttccggatcccttgg
aaacacgctggcaagcaagattataatcaggaagtggatgcctccatttttaaggcctgg
gcagtttttaaagggaagtttaaagaaggggacaaagctgaaccagccacttggaagacg
aggttacgctgtgctttgaataagagcccagattttgaggaagtgacggaccggtcccaa
ctggacatttccgagccatacaaagtttaccgaattgttcctgaggaagagcaaaaatgc
aaactaggcgtggcaactgctggctgcgtgaatgaagttacagagatggagtgcggtcgc
tctgaaatcgacgagctgatcaaggagccttctgtggacgattacatggggatgatcaaa
aggagcccttccccgccggaggcctgtcggagtcagctccttccagactggtgggcgcag
cagcccagcacaggcgtgccgctggtgacggggtacaccacctacgacgcgcaccattca
gcattctcccagatggtgatcagcttctactatgggggcaagctggtgggccaggccacc
accacctgccccgagggctgccgcctgtccctgagccagcctgggctgcccggcaccaag
ctgtatgggcccgagggcctggagctggtgcgcttcccgccggccgacgccatccccagc
gagcgacagaggcaggtgacgcggaagctgttcgggcacctggagcgcggggtgctgctg
cacagcagccggcagggcgtgttcgtcaagcggctgtgccagggccgcgtgttctgcagc
ggcaacgccgtggtgtgcaaaggcaggcccaacaagctggagcgtgatgaggtggtccag
gtcttcgacaccagccagttcttccgagagctgcagcagttctataacagccagggccgg
cttcctgacggcagggtggtgctgtgctttggggaagagtttccggatatggcccccttg
cgctccaaactcattctcgtgcagattgagcagctgtatgtccggcaactggcagaagag
gctgggaagagctgtggagccggctctgtgatgcaggcccccgaggagccgccgccagac
caggtcttccggatgtttccagatatttgtgcctcacaccagagatcatttttcagagaa
aaccaacagatcaccgtctaa

DBGET integrated database retrieval system