KEGG   Homo sapiens (human): 3397Help
Entry
3397              CDS       T01001                                 

Gene name
ID1, ID, bHLHb24
Definition
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Orthology
K04680  
DNA-binding protein inhibitor ID1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11
AA seq 155 aa AA seqDB search
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag
gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg
gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag
caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg
cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac
tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc
cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg
gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga

DBGET integrated database retrieval system