KEGG   Homo sapiens (human): 3397Help
Entry
3397              CDS       T01001                                 

Gene name
ID1, ID, bHLHb24
Definition
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Orthology
K04680  
DNA-binding protein inhibitor ID1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    3397 (ID1)
   04350 TGF-beta signaling pathway
    3397 (ID1)
   04390 Hippo signaling pathway
    3397 (ID1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    3397 (ID1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3397 (ID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11
AA seq 155 aa AA seqDB search
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag
gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg
gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag
caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg
cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac
tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc
cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg
gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga

DBGET integrated database retrieval system