KEGG   Homo sapiens (human): 3399Help
Entry
3399              CDS       T01001                                 

Gene name
ID3, HEIR-1, bHLHb25
Definition
inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Orthology
K17694  
DNA-binding protein inhibitor ID3
Organism
hsa  Homo sapiens (human)
Pathway
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    3399 (ID3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3399 (ID3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.13-p36.12
AA seq 119 aa AA seqDB search
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgc
agtctggccatcgcccggggccgagggaagggcccggcagctgaggagccgctgagcttg
ctggacgacatgaaccactgctactcccgcctgcgggaactggtacccggagtcccgaga
ggcactcagcttagccaggtggaaatcctacagcgcgtcatcgactacattctcgacctg
caggtagtcctggccgagccagcccctggaccccctgatggcccccaccttcccatccag
acagccgagctcactccggaacttgtcatctccaacgacaaaaggagcttttgccactga

DBGET integrated database retrieval system