KEGG   Homo sapiens (human): 34Help
Entry
34                CDS       T01001                                 

Gene name
ACADM, ACAD1, MCAD, MCADH
Definition
acyl-CoA dehydrogenase, C-4 to C-12 straight chain (EC:1.3.8.7)
Orthology
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Leucine degradation, leucine => acetoacetate + acetyl-CoA
beta-Oxidation
Disease
H00525  
Disorders of fatty-acid oxidation
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    34 (ACADM)
   01212 Fatty acid metabolism
    34 (ACADM)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    34 (ACADM)
  Lipid metabolism
   00071 Fatty acid degradation
    34 (ACADM)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    34 (ACADM)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    34 (ACADM)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    34 (ACADM)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     34 (ACADM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31
AA seq 421 aa AA seqDB search
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQ
TAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAF
AGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggggttcgggcgatgctgcagggtcctgagaagtatttctcgttttcattgg
agatcacagcatacaaaagccaatcgacaacgtgaaccaggattaggatttagttttgag
ttcaccgaacagcagaaagaatttcaagctactgctcgtaaatttgccagagaggaaatc
atcccagtggctgcagaatatgataaaactggtgaatatccagtccccctaattagaaga
gcctgggaacttggtttaatgaacacacacattccagagaactgtggaggtcttggactt
ggaacttttgatgcttgtttaattagtgaagaattggcttatggatgtacaggggttcag
actgctattgaaggaaattctttggggcaaatgcctattattattgctggaaatgatcaa
caaaagaagaagtatttggggagaatgactgaggagccattgatgtgtgcttattgtgta
acagaacctggagcaggctctgatgtagctggtataaagaccaaagcagaaaagaaagga
gatgagtatattattaatggtcagaagatgtggataaccaacggaggaaaagctaattgg
tattttttattggcacgttctgatccagatcctaaagctcctgctaataaagcctttact
ggattcattgtggaagcagataccccaggaattcagattgggagaaaggaattaaacatg
ggccagcgatgttcagatactagaggaattgtcttcgaagatgtgaaagtgcctaaagaa
aatgttttaattggtgacggagctggtttcaaagttgcaatgggagcttttgataaaacc
agacctgtagtagctgctggtgctgttggattagcacaaagagctttggatgaagctacc
aagtatgccctggaaaggaaaactttcggaaagctacttgtagagcaccaagcaatatca
tttatgctggctgaaatggcaatgaaagttgaactagctagaatgagttaccagagagca
gcttgggaggttgattctggtcgtcgaaatacctattatgcttctattgcaaaggcattt
gctggagatattgcaaatcagttagctactgatgctgtgcagatacttggaggcaatgga
tttaatacagaatatcctgtagaaaaactaatgagggatgccaaaatctatcagatttat
gaaggtacttcacaaattcaaagacttattgtagcccgtgaacacattgacaagtacaaa
aattaa

DBGET integrated database retrieval system