KEGG   Homo sapiens (human): 340024Help
Entry
340024            CDS       T01001                                 

Gene name
SLC6A19, B0AT1, HND
Definition
solute carrier family 6 (neutral amino acid transporter), member 19
Orthology
K05334  
solute carrier family 6 (neurotransmitter transporter) member 19
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Mineral absorption
Disease
H00843  
Hartnup disorder
H00905  
Iminoglycinuria
H01304  
Hyperglycinuria
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Organismal Systems; Digestive system; Mineral absorption [PATH:hsa04978]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.33
AA seq 634 aa AA seqDB search
MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPY
LCQSHGGGAFMIPFLILLVLEGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGLGLASML
TSFMVGLYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRET
LNISTSISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTGKAVYITSTLPYVVLTIFLIR
GLTLKGATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFSLAFGGLISFSSYNSVHNNCE
KDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQENF
VDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSPLWSVLF
FIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQY
WLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPL
LMLIIFLFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGY
AIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggctcgtgctgcccaaccccggcctagacgcccggatcccgtccctggctgag
ctggagaccatcgagcaggaggaggccagctcccggccgaagtgggacaacaaggcgcag
tacatgctcacctgcctgggcttctgcgtgggcctcggcaacgtgtggcgcttcccctac
ctgtgtcagagccacggaggaggagccttcatgatcccgttcctcatcctgctggtcctg
gagggcatccccctgctgtacctggagttcgccatcgggcagcggctgcggcggggcagc
ctgggtgtgtggagctccatccacccggccctgaagggcctaggcctggcctccatgctc
acgtccttcatggtgggactgtattacaacaccatcatctcctggatcatgtggtactta
ttcaactccttccaggagcctctgccctggagcgactgcccgctcaacgagaaccagaca
gggtatgtggacgagtgcgccaggagctcccctgtggactacttctggtaccgagagacg
ctcaacatctccacgtccatcagcgactcgggctccatccagtggtggatgctgctgtgc
ctggcctgcgcatggagcgtcctgtacatgtgcaccatccgcggcatcgagaccaccggg
aaggccgtgtacatcacctccacgctgccctatgtcgtcctgaccatcttcctcatccga
ggcctgacgctgaagggcgccaccaatggcatcgtcttcctcttcacgcccaacgtcacg
gagctggcccagccggacacctggctggacgcgggcgcacaggtcttcttctccttctcc
ctggccttcgggggcctcatctccttctccagctacaactctgtgcacaacaactgcgag
aaggactcggtgattgtgtccatcatcaacggcttcacatcggtgtatgtggccatcgtg
gtctactccgtcattgggttccgcgccacacagcgctacgacgactgcttcagcacgaac
atcctgaccctcatcaacgggttcgacctgcctgaaggcaacgtgacccaggagaacttt
gtggacatgcagcagcggtgcaacgcctccgaccccgcggcctacgcgcagctggtgttc
cagacctgcgacatcaacgccttcctctcagaggccgtggagggcacaggcctggccttc
atcgtcttcaccgaggccatcaccaagatgccgttgtccccactgtggtctgtgctcttc
ttcattatgctcttctgcctggggctgtcatctatgtttgggaacatggagggcgtcgtt
gtgcccctgcaggacctcagagtcatccccccgaagtggcccaaggaggtgctcacaggc
ctcatctgcctggggacattcctcattggcttcatcttcacgctgaactccggccagtac
tggctctccctgctggacagctatgccggctccattcccctgctcatcatcgccttctgc
gagatgttctctgtggtctacgtgtacggtgtggacaggttcaataaggacatcgagttc
atgatcggccacaagcccaacatcttctggcaagtcacgtggcgcgtggtcagccccctg
ctcatgctgatcatcttcctcttcttcttcgtggtagaggtcagtcaggagctgacctac
agcatctgggaccctggctacgaggaatttcccaaatcccagaagatctcctacccgaac
tgggtgtatgtggtggtggtgattgtggctggagtgccctccctcaccatccctggctat
gccatctacaagctcatcaggaaccactgccagaagccaggggaccatcaggggctggtg
agcacactgtccacagcctccatgaacggggacctgaagtactga

DBGET integrated database retrieval system