KEGG   Homo sapiens (human): 340061Help
Entry
340061            CDS       T01001                                 

Gene name
TMEM173, ERIS, MITA, MPYS, NET23, SAVI, STING, hMITA, hSTING
Definition
(RefSeq) transmembrane protein 173
  KO
K12654  transmembrane protein 173
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
Disease
H01746  STING-associated vasculopathy with onset in infancy (SAVI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    340061 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    340061 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    340061 (TMEM173)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    340061 (TMEM173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM173 Flavi_NS4B
Motif
Other DBs
NCBI-GeneID: 340061
NCBI-ProteinID: NP_938023
OMIM: 612374
HGNC: 27962
Ensembl: ENSG00000184584
Vega: OTTHUMG00000129239
Pharos: Q86WV6(Tbio)
UniProt: Q86WV6
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 379 aa AA seqDB search
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccccactccagcctgcatccatccatcccgtgtcccaggggtcacggggcccagaag
gcagccttggttctgctgagtgcctgcctggtgaccctttgggggctaggagagccacca
gagcacactctccggtacctggtgctccacctagcctccctgcagctgggactgctgtta
aacggggtctgcagcctggctgaggagctgcgccacatccactccaggtaccggggcagc
tactggaggactgtgcgggcctgcctgggctgccccctccgccgtggggccctgttgctg
ctgtccatctatttctactactccctcccaaatgcggtcggcccgcccttcacttggatg
cttgccctcctgggcctctcgcaggcactgaacatcctcctgggcctcaagggcctggcc
ccagctgagatctctgcagtgtgtgaaaaagggaatttcaacgtggcccatgggctggca
tggtcatattacatcggatatctgcggctgatcctgccagagctccaggcccggattcga
acttacaatcagcattacaacaacctgctacggggtgcagtgagccagcggctgtatatt
ctcctcccattggactgtggggtgcctgataacctgagtatggctgaccccaacattcgc
ttcctggataaactgccccagcagaccggtgaccatgctggcatcaaggatcgggtttac
agcaacagcatctatgagcttctggagaacgggcagcgggcgggcacctgtgtcctggag
tacgccacccccttgcagactttgtttgccatgtcacaatacagtcaagctggctttagc
cgggaggataggcttgagcaggccaaactcttctgccggacacttgaggacatcctggca
gatgcccctgagtctcagaacaactgccgcctcattgcctaccaggaacctgcagatgac
agcagcttctcgctgtcccaggaggttctccggcacctgcggcaggaggaaaaggaagag
gttactgtgggcagcttgaagacctcagcggtgcccagtacctccacgatgtcccaagag
cctgagctcctcatcagtggaatggaaaagcccctccctctccgcacggatttctcttga

DBGET integrated database retrieval system