KEGG   Homo sapiens (human): 340061Help
Entry
340061            CDS       T01001                                 

Gene name
TMEM173, ERIS, MITA, MPYS, NET23, STING
Definition
transmembrane protein 173
Orthology
K12654  
transmembrane protein 173
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    340061 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    340061 (TMEM173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 379 aa AA seqDB search
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccccactccagcctgcatccatccatcccgtgtcccaggggtcacggggcccagaag
gcagccttggttctgctgagtgcctgcctggtgaccctttgggggctaggagagccacca
gagcacactctccggtacctggtgctccacctagcctccctgcagctgggactgctgtta
aacggggtctgcagcctggctgaggagctgcgccacatccactccaggtaccggggcagc
tactggaggactgtgcgggcctgcctgggctgccccctccgccgtggggccctgttgctg
ctgtccatctatttctactactccctcccaaatgcggtcggcccgcccttcacttggatg
cttgccctcctgggcctctcgcaggcactgaacatcctcctgggcctcaagggcctggcc
ccagctgagatctctgcagtgtgtgaaaaagggaatttcaacgtggcccatgggctggca
tggtcatattacatcggatatctgcggctgatcctgccagagctccaggcccggattcga
acttacaatcagcattacaacaacctgctacggggtgcagtgagccagcggctgtatatt
ctcctcccattggactgtggggtgcctgataacctgagtatggctgaccccaacattcgc
ttcctggataaactgccccagcagaccggtgaccatgctggcatcaaggatcgggtttac
agcaacagcatctatgagcttctggagaacgggcagcgggcgggcacctgtgtcctggag
tacgccacccccttgcagactttgtttgccatgtcacaatacagtcaagctggctttagc
cgggaggataggcttgagcaggccaaactcttctgccggacacttgaggacatcctggca
gatgcccctgagtctcagaacaactgccgcctcattgcctaccaggaacctgcagatgac
agcagcttctcgctgtcccaggaggttctccggcacctgcggcaggaggaaaaggaagag
gttactgtgggcagcttgaagacctcagcggtgcccagtacctccacgatgtcccaagag
cctgagctcctcatcagtggaatggaaaagcccctccctctccgcacggatttctcttga

DBGET integrated database retrieval system