KEGG   Homo sapiens (human): 340061Help
Entry
340061            CDS       T01001                                 

Gene name
TMEM173, ERIS, MITA, MPYS, NET23, SAVI, STING, hMITA, hSTING
Definition
transmembrane protein 173
Orthology
K12654  
transmembrane protein 173
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    340061 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    340061 (TMEM173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.2
AA seq 283 aa AA seqDB search
MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLL
NGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWM
LALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIR
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVY
SNSIYELLENGQRNLQMTAASRCPRRFSGTCGRRKRKRLLWAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccccactccagcctgcatccatccatcccgtgtcccaggggtcacggggcccagaag
gcagccttggttctgctgagtgcctgcctggtgaccctttgggggctaggagagccacca
gagcacactctccggtacctggtgctccacctagcctccctgcagctgggactgctgtta
aacggggtctgcagcctggctgaggagctgcgccacatccactccaggtaccggggcagc
tactggaggactgtgcgggcctgcctgggctgccccctccgccgtggggccctgttgctg
ctgtccatctatttctactactccctcccaaatgcggtcggcccgcccttcacttggatg
cttgccctcctgggcctctcgcaggcactgaacatcctcctgggcctcaagggcctggcc
ccagctgagatctctgcagtgtgtgaaaaagggaatttcaacgtggcccatgggctggca
tggtcatattacatcggatatctgcggctgatcctgccagagctccaggcccggattcga
acttacaatcagcattacaacaacctgctacggggtgcagtgagccagcggctgtatatt
ctcctcccattggactgtggggtgcctgataacctgagtatggctgaccccaacattcgc
ttcctggataaactgccccagcagaccggtgaccatgctggcatcaaggatcgggtttac
agcaacagcatctatgagcttctggagaacgggcagcggaacctgcagatgacagcagct
tctcgctgtcccaggaggttctccggcacctgcggcaggaggaaaaggaagaggttactg
tgggcagcttga

DBGET integrated database retrieval system