KEGG   Homo sapiens (human): 340273Help
Entry
340273            CDS       T01001                                 

Gene name
ABCB5, ABCB5alpha, ABCB5beta, EST422562
Definition
(RefSeq) ATP binding cassette subfamily B member 5 (EC:3.6.3.44)
  KO
K05660  
ATP-binding cassette, subfamily B (MDR/TAP), member 5
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    340273 (ABCB5)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5, 11 subgroups
    340273 (ABCB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7p21.1
AA seq 1257 aa AA seqDB search
MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGA
CLPLMPLVLGEMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIF
GYIQISLWIITAARQTKRIRKQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGD
KIALLFQNMSTFSIGLAVGLVKGWKLTLVTLSTSPLIMASAAACSRMVISLTSKELSAYS
KAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFGIKRTIASKVSLGAVYFFMNG
TYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFAIARGAAFHIF
QVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISN
NIKYGRDDVTDEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALV
RNPKILILDEATSALDSESKSAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGML
AEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFID
KAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASVLNGTVHPVFSIIFAKIITMF
GNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRHLAFKAMLYQD
IAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMY
EEMLQTQHRNTSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTA
IAYGAMAIGETLVLAPEYSKAKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREV
SFFYPCRPDVFILRGLSLSIERGKTVAFVGSSGCGKSTSVQLLQRLYDPVQGQVLFDGVD
AKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVVPLDEIKEAANAANIHSFIEG
LPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDSEKVVQHALDK
ARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattcagaaagagctgaagaaatgcaagaaaattatcagagaaatggaactgca
gaagaacagccaaaactgagaaaggaagcagttggatctattgagatattccgctttgct
gatggactggacatcacactcatgatcctgggtatactggcatcactggtcaatggagcc
tgccttcctttaatgccactggttttaggagaaatgagtgataaccttattagtggatgt
ctagtccaaactaacacaacaaattatcagaactgtactcagtctcaagagaagctgaat
gaagatatgactctgttgaccctgtattatgttggaataggtgttgctgccttgattttt
ggttacatacagatttccttgtggattataactgcagcacgacagaccaagaggattcga
aaacagttttttcattcagttttggcacaggacatcggctggtttgatagctgtgacatc
ggtgaacttaacactcgcatgacagatgacattgacaaaatcagtgatggtattggagat
aagattgctctgttgtttcaaaacatgtctactttttcgattggcctggcagttggtttg
gtgaagggctggaaactcaccctagtgactctatccacgtctcctcttataatggcttca
gcggcagcatgttctaggatggtcatctcattgaccagtaaggaattaagtgcctattcc
aaagctggggctgtggcagaagaagtcttgtcatcaatccgaacagtcatagcctttagg
gcccaggagaaagaacttcaaaggtatacacagaatctcaaagatgcaaaggattttggc
ataaaaaggactatagcttcaaaagtgtctcttggtgctgtgtacttctttatgaatgga
acctatggacttgctttttggtatggaacctccttgattcttaatggagaacctggatat
accatcgggactgttcttgctgttttctttagtgtaatccatagcagttattgcattgga
gcagcagtccctcactttgaaaccttcgcaatagcccgaggagctgcctttcatattttc
caggttattgataagaaacccagtatagataacttttccacagctggatataaacctgaa
tccatagaaggaactgtggaatttaaaaatgtttctttcaattatccatcaagaccatct
atcaagattctgaaaggtctgaatctcagaattaagtctggagagacagtcgccttggtc
ggtctcaatggcagtgggaagagtacggtagtccagcttctgcagaggttatatgatccg
gatgatggctttatcatggtggatgagaatgacatcagagctttaaatgtgcggcattat
cgagaccatattggagtggttagtcaagagcctgttttgttcgggaccaccatcagtaac
aatatcaagtatggacgagatgatgtgactgatgaagagatggagagagcagcaagggaa
gcaaatgcgtatgattttatcatggagtttcctaataaatttaatacattggtaggggaa
aaaggagctcaaatgagtggagggcagaaacagaggatcgcaattgctcgtgccttagtt
cgaaaccccaagattctgattttagatgaggctacgtctgccctggattcagaaagcaag
tcagctgttcaagctgcactggagaaggcgagcaaaggtcggactacaatcgtggtagca
caccgactttctactattcgaagtgcagatttgattgtgaccctaaaggatggaatgctg
gcggagaaaggagcacatgctgaactaatggcaaaacgaggtctatattattcacttgtg
atgtcacaggatattaaaaaagctgatgaacagatggagtcaatgacatattctactgaa
agaaagaccaactcacttcctctgcactctgtgaagagcatcaagtcagacttcattgac
aaggctgaggaatccacccaatctaaagagataagtcttcctgaagtctctctattaaaa
attttaaagttaaacaagcctgaatggccttttgtggttctggggacattggcttctgtt
ctaaatggaactgttcatccagtattttccatcatctttgcaaaaattataaccatgttt
ggaaataatgataaaaccacattaaagcatgatgcagaaatttattccatgatattcgtc
attttgggtgttatttgctttgtcagttatttcatgcagggattattttacggcagagca
ggggaaattttaacgatgagattaagacacttggccttcaaagccatgttatatcaggat
attgcctggtttgatgaaaaggaaaacagcacaggaggcttgacaacaatattagccata
gatatagcacaaattcaaggagcaacaggttccaggattggcgtcttaacacaaaatgca
actaacatgggactttcagttatcatttcctttatatatggatgggagatgacattcctg
attctgagtattgctccagtacttgccgtgacaggaatgattgaaaccgcagcaatgact
ggatttgccaacaaagataagcaagaacttaagcatgctggaaagatagcaactgaagct
ttggagaatatacgtactatagtgtcattaacaagggaaaaagccttcgagcaaatgtat
gaagagatgcttcagactcaacacagaaatacctcgaagaaagcacagattattggaagc
tgttatgcattcagccatgcctttatatattttgcctatgcggcagggtttcgatttgga
gcctatttaattcaagctggacgaatgaccccagagggcatgttcatagtttttactgca
attgcatatggagctatggccatcggagaaacgctcgttttggctcctgaatattccaaa
gccaaatcgggggctgcgcatctgtttgccttgttggaaaagaaaccaaatatagacagc
cgcagtcaagaagggaaaaagccagacacatgtgaagggaatttagagtttcgagaagtc
tctttcttctatccatgtcgcccagatgttttcatcctccgtggcttatccctcagtatt
gagcgaggaaagacagtagcatttgtggggagcagcggctgtgggaaaagcacttctgtt
caacttctgcagagactttatgaccccgtgcaaggacaagtgctgtttgatggtgtggat
gcaaaagaattgaatgtacagtggctccgttcccaaatagcaatcgttcctcaagagcct
gtgctcttcaactgcagcattgctgagaacatcgcctatggtgacaacagccgtgtggtg
ccattagatgagatcaaagaagccgcaaatgcagcaaatatccattcttttattgaaggt
ctccctgagaaatacaacacacaagttggactgaaaggagcacagctttctggcggccag
aaacaaagactagctattgcaagggctcttctccaaaaacccaaaattttattgttggat
gaggccacttcagccctcgataatgacagtgagaaggtggttcagcatgcccttgataaa
gccaggacgggaaggacatgcctagtggtcactcacaggctctctgcaattcagaacgca
gatttgatagtggttctgcacaatggaaagataaaggaacaaggaactcatcaagagctc
ctgagaaatcgagacatatattttaagttagtgaatgcacagtcagtgcagtga

DBGET integrated database retrieval system