KEGG   Homo sapiens (human): 340665Help
Entry
340665            CDS       T01001                                 

Gene name
CYP26C1, FFDD4
Definition
cytochrome P450, family 26, subfamily C, polypeptide 1
Orthology
K12665  
cytochrome P450, family 26, subfamily C
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Drug target
Other: 
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q23.33
AA seq 522 aa AA seqDB search
MFPWGLSCLSVLGAAGTALLCAGLLLSLAQHLWTLRWMLSRDRASTLPLPKGSMGWPFFG
ETLHWLVQGSRFHSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQS
AHILLGSHTLLGAVGEPHRRRRKVLARVFSRAALERYVPRLQGALRHEVRSWCAAGGPVS
VYDASKALTFRMAARILLGLRLDEAQCATLARTFEQLVENLFSLPLDVPFSGLRKGIRAR
DQLHRHLEGAISEKLHEDKAAEPGDALDLIIHSARELGHEPSMQELKESAVELLFAAFFT
TASASTSLVLLLLQHPAAIAKIREELVAQGLGRACGCAPGAAGGSEGPPPDCGCEPDLSL
AALGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHETAAV
YRSPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTA
RWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttcccttgggggctgagctgcctgtcagtgctgggggcggcgggcactgctctcctg
tgcgcgggcctgctgctcagcctggcccagcacctctggaccctccgctggatgctgagc
cgggaccgggcctccaccctgcctctgcccaagggctccatggggtggcccttcttcggc
gaaacgctgcactggttagttcagggctcgcgcttccacagttctcgccgagagcgctat
gggacagtgttcaagacgcacctgctgggcaggccagtgatccgcgtgagcggcgcggag
aacgtgcgcaccatcctgctgggcgagcaccgcctggtgcgcagccagtggccgcagagt
gcgcacatcctgctgggctcgcacacactgctaggtgcggtcggcgagccgcaccggcgg
cggcgcaaggtcctggcgcgcgtgttcagccgcgccgcgctggagcgctacgtgccgcgc
ctgcagggggcgctgcggcatgaggtgcgctcctggtgcgcggcgggcgggccggtctca
gtctacgacgcctccaaagcgctcaccttccgcatggccgcgcgcatcctgctggggttg
cggctggacgaggcgcagtgcgccacgctggcccggaccttcgagcagctcgtggagaac
ctcttctcactgcctctggacgttcccttcagtggcctacgcaagggcatccgggcaagg
gaccagctgcatcggcacctggagggggccatttctgagaagcttcacgaggacaaggct
gcagagccgggtgatgccctcgacctaatcattcacagtgcaagggagctgggccatgag
ccctccatgcaggagctgaaggagtcggctgtggagctcctcttcgccgccttcttcacc
acggccagtgccagcacctcgctcgtcctgctgctactgcagcatccggcggccatcgcc
aagattcgggaggagctggtggcgcaggggctggggcgcgcgtgcggctgcgcgcccggg
gccgctgggggcagcgaggggcccccgcccgactgcggctgcgagcccgacctcagcctc
gcggcgctgggccgtctgcgctacgtcgactgcgtggtcaaggaggtgctgcgcctcctg
ccgccagtgtccgggggctaccgcaccgccctgcgcaccttcgagctcgacggctaccag
atccccaagggctggagcgtgatgtatagcatccgggacacgcacgagacggctgcggtg
taccgcagccctcccgaaggcttcgatccagagcgcttcggcgcagcgcgcgaagattcc
cggggcgcctccagccgcttccattacatcccgttcggcggcggtgcgcgcagctgcctc
ggccaggagctggcgcaagccgtgctccagctgctagctgtggagctagtgcgcaccgcg
cgctgggaactggccacacccgccttccccgccatgcagacggtgcccatcgtgcaccca
gtggacgggctgcggctctttttccaccccctcacgccttcggttgcggggaatgggcta
tgcctctga

DBGET integrated database retrieval system