KEGG   Homo sapiens (human): 340980Help
Entry
340980            CDS       T01001                                 

Gene name
OR52B6, OR11-47
Definition
(RefSeq) olfactory receptor family 52 subfamily B member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    340980 (OR52B6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    340980 (OR52B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 340980
NCBI-ProteinID: NP_001005162
HGNC: 15211
Ensembl: ENSG00000187747
Vega: OTTHUMG00000066906
Pharos: Q8NGF0(Tdark)
UniProt: Q8NGF0
Position
11p15.4
AA seq 335 aa AA seqDB search
MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE
GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ
MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF
LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI
LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY
VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtgagggcgctgcataaaatcatggcccttttttctgctaacagcataggt
gctatgaacaactctgacactcgcatagcaggctgcttcctcactggcatccctgggctg
gagcaactacatatctggctgtccatccccttctgcatcatgtacatcactgccctggaa
ggcaatggcatcctaatttgtgtcatcctctcccaggcaatcctgcatgagcccatgtac
atattcttatctatgctggccagtgctgatgtcttgctctctaccaccaccatgcctaag
gccctggccaatttgtggctaggttatagcctcatttcctttgatggctgcctcactcag
atgttcttcattcacttcctcttcattcactctgctgtcctgctggccatggcctttgac
cgctatgtggccatctgctcccccctgcgatatgtcacaatcctcacaagcaaggtcatt
gggaagatcgtcactgccgccctgagccacagcttcatcattatgtttccatccatcttt
ctccttgagcacctgcactattgccagatcaatatcattgcacacacattttgtgagcac
atgggcattgcccatctgtcctgttctgatatctccatcaatgtctggtatgggttggca
gctgctcttctctccacaggcctagacatcatgcttattactgtttcctacatccacatc
ctccaagcagtcttccgcctcctttctcaagatgcccgctccaaggccctgagtacctgt
ggatcccatatctgtgtcatcctactcttctatgtccctgcgcttttttctgtctttgcc
tacaggtttggtgggagaagcgtcccatgctatgtccatattctcctggccagcctctac
gttgtcattcctcctatgctcaatcccgttatttatggagtgaggactaagccaatactg
gaaggggctaagcagatgttttcaaatcttgccaaaggatctaaataa

DBGET integrated database retrieval system