KEGG   Homo sapiens (human): 341Help
Entry
341               CDS       T01001                                 

Gene name
APOC1, Apo-CI, ApoC-I, apo-CIB, apoC-IB
Definition
(RefSeq) apolipoprotein C1
  KO
K22286  apolipoprotein C-I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04979 Cholesterol metabolism
    341 (APOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoC-I Apo-CIII YtxH
Motif
Other DBs
NCBI-GeneID: 341
NCBI-ProteinID: NP_001307994
OMIM: 107710
HGNC: 607
Ensembl: ENSG00000130208
Vega: OTTHUMG00000180844
Pharos: P02654(Tbio)
UniProt: P02654 A0A024R0T8
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 83 aa AA seqDB search
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
SAKMREWFSETFQKVKEKLKIDS
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcttcctgtcgctcccggtcctggtggtggttctgtcgatcgtcttggaaggc
ccagccccagcccaggggaccccagacgtctccagtgccttggataagctgaaggagttt
ggaaacacactggaggacaaggctcgggaactcatcagccgcatcaaacagagtgaactt
tctgccaagatgcgggagtggttttcagagacatttcagaaagtgaaggagaaactcaag
attgactcatga

DBGET integrated database retrieval system