KEGG   Homo sapiens (human): 341Help
Entry
341               CDS       T01001                                 

Gene name
APOC1, Apo-CI, ApoC-I, apo-CIB, apoC-IB
Definition
(RefSeq) apolipoprotein C1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 83 aa AA seqDB search
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
SAKMREWFSETFQKVKEKLKIDS
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcttcctgtcgctcccggtcctggtggtggttctgtcgatcgtcttggaaggc
ccagccccagcccaggggaccccagacgtctccagtgccttggataagctgaaggagttt
ggaaacacactggaggacaaggctcgggaactcatcagccgcatcaaacagagtgaactt
tctgccaagatgcgggagtggttttcagagacatttcagaaagtgaaggagaaactcaag
attgactcatga

DBGET integrated database retrieval system