KEGG   Homo sapiens (human): 341276Help
Entry
341276            CDS       T01001                                 

Gene name
OR10A2, OR10A2P, OR11-82, OR11-86, OST363
Definition
(RefSeq) olfactory receptor family 10 subfamily A member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    341276 (OR10A2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    341276 (OR10A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 341276
NCBI-ProteinID: NP_001004460
HGNC: 8161
Ensembl: ENSG00000170790
Vega: OTTHUMG00000165739
Pharos: Q9H208(Tdark)
UniProt: Q9H208
Position
11p15.4
AA seq 303 aa AA seqDB search
MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPMLHSPMYFFLRNLSFLEIGF
NLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYP
VIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTA
LFEIYAIVGTILVVMIPCLLILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYI
SLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLRNNEVKNALSRTVSKALALRN
CIP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctcttccctgcctactgaaatacagtcattactctttctgacatttctaacc
atctacctggtcaccctgatgggaaactgcctcatcattctggttaccctagctgacccc
atgctacacagccccatgtacttcttcctcagaaacttatctttcctggagattggcttc
aacctagtcattgtgcccaaaatgctggggaccctgcttgcccaggacacaaccatctcc
ttccttggctgtgccactcagatgtatttcttcttcttctttggagtggctgaatgcttc
ctcctggctaccatggcatatgaccgctatgtggccatctgcagtcccttgcactaccca
gtcatcatgaaccaaaggactcgtgccaaactggctgctgcctcctggttcccaggcttt
cctgtagctactgtgcagaccacatggctcttcagttttccattctgtggcaccaacaag
gtgaaccacttcttctgtgacagcccacctgtgctgaggctggtctgtgcagacacagca
ctctttgagatctacgccatcgtcggaaccattctggtggtcatgatcccctgcttgctg
atcttgtgttcctatactcacattgctgctgccatcctcaagatcccatcagctaaaggg
aagaataaagccttttctacatgttcctcacacctccttgttgtctctcttttctatata
tcattaagcctcacctacttccggcctaaatcaaataattcacctgagggcaagaagctg
ctatcattgtcctacactgttatgactcccatgttgaaccccattatctacagcctgaga
aataacgaggtgaagaatgccctcagcaggacggtctctaaggccctagccctcagaaac
tgtatcccatag

DBGET integrated database retrieval system