KEGG   Homo sapiens (human): 341418Help
Entry
341418            CDS       T01001                                 

Gene name
OR6C4, OR12-10
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    341418 (OR6C4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    341418 (OR6C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 341418
NCBI-ProteinID: NP_001005494
HGNC: 19632
Ensembl: ENSG00000179626
Vega: OTTHUMG00000169959
Pharos: Q8NGE1(Tdark)
UniProt: Q8NGE1
Position
12q13.2
AA seq 309 aa AA seqDB search
MKNRTMFGEFILLGLTNQPELQVMIFIFLFLTYMLSILGNLTIITLTLLDPHLQTPMYFF
LRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDR
YVAICKPLHYLTIMSSRVCIQLVFCSWLGGFLAILPPIILMTQVDFCVSNILNHYYCDYG
PLVELACSDTSLLELMVILLAVVTLMVTLVLVTLSYTYIIRTILRIPSAQQRTKAFSTCS
SHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFK
DSVKKIVKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagaaccatgtttggtgagtttattctactgggccttacaaatcaacctgaa
ctccaagtgatgatattcatctttctgttcctcacctacatgctaagtatcctaggaaat
ctgactattatcaccctcaccttactagacccccacctccagacccccatgtatttcttc
ctccggaatttctccttcttagaaatttccttcacatccatttttattcccagatttctg
accagcatgacaacaggaaataaagttatcagctttgctggctgcttgactcagtatttt
tttgctatatttcttggagctaccgagttttacctcctggcctccatgtcttatgatcgt
tatgtggccatctgcaaacccttgcattacctgactattatgagcagcagagtctgcata
caactagtgttctgctcctggttggggggattcctagcaatcttaccaccaatcatcctg
atgacccaggtagatttctgtgtctccaacattctgaatcactattactgtgactatggg
cctctcgtggagcttgcctgctcagacacaagcctcttagaactgatggtcatcctcttg
gccgttgtgactctcatggttactctggtgctggtgacactttcttacacatacattatc
aggactattctgaggatcccttctgcccagcaaaggacaaaggccttttccacttgttcc
tcccacatgattgtcatctccctctcttatggcagctgcatgtttatgtacattaatcct
tctgcaaaagaaggaggtgctttcaacaaaggaatagctgtactcattacttcggttact
cccttactgaatcccttcatatatactttaagaaatcagcaagtgaaacaagctttcaag
gactcagtcaaaaagattgtgaaactttaa

DBGET integrated database retrieval system