KEGG   Homo sapiens (human): 3417Help
Entry
3417              CDS       T01001                                 

Gene name
IDH1, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD
Definition
isocitrate dehydrogenase 1 (NADP+), soluble (EC:1.1.1.42)
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hsa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hsa00480]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.3
AA seq 414 aa AA seqDB search
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaaatcagtggcggttctgtggtagagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaagagaaactcatttttccctacgtggaattggatctacat
agctatgatttaggcatagagaatcgtgatgccaccaacgaccaagtcaccaaggatgct
gcagaagctataaagaagcataatgttggcgtcaaatgtgccactatcactcctgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaaatcaccaaatggcaccatacga
aatattctgggtggcacggtcttcagagaagccattatctgcaaaaatatcccccggctt
gtgagtggatgggtaaaacctatcatcataggtcgtcatgcttatggggatcaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaagtgac
ggaacccaaaaggtgacatacctggtacataactttgaagaaggtggtggtgttgccatg
gggatgtataatcaagataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtctaagggttggcctttgtatctgagcaccaaaaacactattctgaagaaatatgat
gggcgttttaaagacatctttcaggagatatatgacaagcagtacaagtcccagtttgaa
gctcaaaagatctggtatgagcataggctcatcgacgacatggtggcccaagctatgaaa
tcagagggaggcttcatctgggcctgtaaaaactatgatggtgacgtgcagtcggactct
gtggcccaagggtatggctctctcggcatgatgaccagcgtgctggtttgtccagatggc
aagacagtagaagcagaggctgcccacgggactgtaacccgtcactaccgcatgtaccag
aaaggacaggagacgtccaccaatcccattgcttccatttttgcctggaccagagggtta
gcccacagagcaaagcttgataacaataaagagcttgccttctttgcaaatgctttggaa
gaagtctctattgagacaattgaggctggcttcatgaccaaggacttggctgcttgcatt
aaaggtttacccaatgtgcaacgttctgactacttgaatacatttgagttcatggataaa
cttggagaaaacttgaagatcaaactagctcaggccaaactttaa

DBGET integrated database retrieval system