KEGG   Homo sapiens (human): 341799Help
Entry
341799            CDS       T01001                                 

Gene name
OR6S1, OR14-37, OR6S1Q
Definition
(RefSeq) olfactory receptor family 6 subfamily S member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    341799 (OR6S1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    341799 (OR6S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx Stevor
Motif
Other DBs
NCBI-GeneID: 341799
NCBI-ProteinID: NP_001001968
HGNC: 15363
Ensembl: ENSG00000181803
Vega: OTTHUMG00000171010
Pharos: Q8NH40(Tdark)
UniProt: Q8NH40
Position
14q11.2
AA seq 331 aa AA seqDB search
MSPDGNHSSDPTEFVLAGLPNLNSARVELFSVFLLVYLLNLTGNVLIVGVVRADTRLQTP
MYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLGASEFLLLAVM
SADRYLAICHPLRYPLLMSGAVCFRVALACWVGGLVPVLGPTVAVALLPFCKQGAVVQHF
FCDSGPLLRLACTNTKKLEETDFVLASLVIVSSLLITAVSYGLIVLAVLSIPSASGRQKA
FSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVITTFVTPLLNPFIYALRNEQV
KEALKDMFRKVVAGVLGNLLLDKCLSEKAVK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgatgggaaccacagtagtgatccaacagagttcgtcctggcagggctccca
aatctcaacagcgcaagagtggaattattttctgtgtttcttcttgtctatctcctgaat
ctgacaggcaatgtgttgattgtgggggtggtaagggctgatactcgactacagacccct
atgtacttctttctgggtaacctgtcctgcctagagatactgctcacttctgtcatcatt
ccaaagatgctgagcaatttcctctcaaggcaacacactatttcctttgctgcatgtatc
acccaattctatttctacttctttctcggggcctccgagttcttactgttggctgtcatg
tctgcggatcgctacctggccatctgtcatcctctgcgctaccccttgctcatgagtggg
gctgtgtgctttcgtgtggccttggcctgctgggtggggggactcgtccctgtgcttggt
cccacagtggctgtggccttgcttcctttctgtaagcagggtgctgtggtacagcacttc
ttctgcgacagtggcccactgctccgcctggcttgcaccaacaccaagaagctggaggag
actgactttgtcctggcctccctcgtcattgtatcttccttgctgatcactgctgtgtcc
tacggcctcattgtgctggcagtcctgagcatcccctctgcttcaggccgtcagaaggcc
ttctctacctgtacctcccacttgatagtggtgaccctcttctatggaagtgccattttt
ctctatgtgcggccatcgcagagtggttctgtggacactaactgggcagtgacagtaata
acgacatttgtgacaccactgttgaatccattcatctatgccttacgtaatgagcaagtc
aaggaagctttgaaggacatgtttaggaaggtagtggcaggcgttttagggaatctttta
cttgataaatgtctcagtgagaaagcagtaaagtaa

DBGET integrated database retrieval system