KEGG   Homo sapiens (human): 3418Help
Entry
3418              CDS       T01001                                 

Gene name
IDH2, D2HGA2, ICD-M, IDH, IDHM, IDP, IDPM, mNADP-IDH
Definition
isocitrate dehydrogenase 2 (NADP+), mitochondrial (EC:1.1.1.42)
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Disease
H01225  
D-2-hydroxyglutaric aciduria (D-2-HGA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    3418 (IDH2)
   01210 2-Oxocarboxylic acid metabolism
    3418 (IDH2)
   01230 Biosynthesis of amino acids
    3418 (IDH2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3418 (IDH2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    3418 (IDH2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    3418 (IDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     3418 (IDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 400 aa AA seqDB search
MDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVK
CATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGR
HAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFA
HSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDD
MVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVT
RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMT
KDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgatgagatgacccgtattatctggcagttcatcaaggagaagctcatcctg
ccccacgtggacatccagctaaagtattttgacctcgggctcccaaaccgtgaccagact
gatgaccaggtcaccattgactctgcactggccacccagaagtacagtgtggctgtcaag
tgtgccaccatcacccctgatgaggcccgtgtggaagagttcaagctgaagaagatgtgg
aaaagtcccaatggaactatccggaacatcctgggggggactgtcttccgggagcccatc
atctgcaaaaacatcccacgcctagtccctggctggaccaagcccatcaccattggcagg
cacgcccatggcgaccagtacaaggccacagactttgtggcagaccgggccggcactttc
aaaatggtcttcaccccaaaagatggcagtggtgtcaaggagtgggaagtgtacaacttc
cccgcaggcggcgtgggcatgggcatgtacaacaccgacgagtccatctcaggttttgcg
cacagctgcttccagtatgccatccagaagaaatggccgctgtacatgagcaccaagaac
accatactgaaagcctacgatgggcgtttcaaggacatcttccaggagatctttgacaag
cactataagaccgacttcgacaagaataagatctggtatgagcaccggctcattgatgac
atggtggctcaggtcctcaagtcttcgggtggctttgtgtgggcctgcaagaactatgac
ggagatgtgcagtcagacatcctggcccagggctttggctcccttggcctgatgacgtcc
gtcctggtctgccctgatgggaagacgattgaggctgaggccgctcatgggaccgtcacc
cgccactatcgggagcaccagaagggccggcccaccagcaccaaccccatcgccagcatc
tttgcctggacacgtggcctggagcaccgggggaagctggatgggaaccaagacctcatc
aggtttgcccagatgctggagaaggtgtgcgtggagacggtggagagtggagccatgacc
aaggacctggcgggctgcattcacggcctcagcaatgtgaagctgaacgagcacttcctg
aacaccacggacttcctcgacaccatcaagagcaacctggacagagccctgggcaggcag
tag

DBGET integrated database retrieval system