KEGG   Homo sapiens (human): 3418Help
Entry
3418              CDS       T01001                                 

Gene name
IDH2, D2HGA2, ICD-M, IDH, IDHM, IDP, IDPM, mNADP-IDH
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 2, mitochondrial
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Disease
H01225  
D-2-hydroxyglutaric aciduria (D-2-HGA)
H01481  
Myelodysplastic syndrome
H01892  
Peripheral T cell lymphoma (PTCL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3418 (IDH2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    3418 (IDH2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    3418 (IDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     3418 (IDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P48735(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 452 aa AA seqDB search
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggccggctacctgcgggtcgtgcgctcgctctgcagagcctcaggctcgcggccggcc
tgggcgccggcggccctgacagcccccacctcgcaagagcagccgcggcgccactatgcc
gacaaaaggatcaaggtggcgaagcccgtggtggagatggatggtgatgagatgacccgt
attatctggcagttcatcaaggagaagctcatcctgccccacgtggacatccagctaaag
tattttgacctcgggctcccaaaccgtgaccagactgatgaccaggtcaccattgactct
gcactggccacccagaagtacagtgtggctgtcaagtgtgccaccatcacccctgatgag
gcccgtgtggaagagttcaagctgaagaagatgtggaaaagtcccaatggaactatccgg
aacatcctgggggggactgtcttccgggagcccatcatctgcaaaaacatcccacgccta
gtccctggctggaccaagcccatcaccattggcaggcacgcccatggcgaccagtacaag
gccacagactttgtggcagaccgggccggcactttcaaaatggtcttcaccccaaaagat
ggcagtggtgtcaaggagtgggaagtgtacaacttccccgcaggcggcgtgggcatgggc
atgtacaacaccgacgagtccatctcaggttttgcgcacagctgcttccagtatgccatc
cagaagaaatggccgctgtacatgagcaccaagaacaccatactgaaagcctacgatggg
cgtttcaaggacatcttccaggagatctttgacaagcactataagaccgacttcgacaag
aataagatctggtatgagcaccggctcattgatgacatggtggctcaggtcctcaagtct
tcgggtggctttgtgtgggcctgcaagaactatgacggagatgtgcagtcagacatcctg
gcccagggctttggctcccttggcctgatgacgtccgtcctggtctgccctgatgggaag
acgattgaggctgaggccgctcatgggaccgtcacccgccactatcgggagcaccagaag
ggccggcccaccagcaccaaccccatcgccagcatctttgcctggacacgtggcctggag
caccgggggaagctggatgggaaccaagacctcatcaggtttgcccagatgctggagaag
gtgtgcgtggagacggtggagagtggagccatgaccaaggacctggcgggctgcattcac
ggcctcagcaatgtgaagctgaacgagcacttcctgaacaccacggacttcctcgacacc
atcaagagcaacctggacagagccctgggcaggcagtag

DBGET integrated database retrieval system