KEGG   Homo sapiens (human): 3419Help
Entry
3419              CDS       T01001                                 

Gene name
IDH3A
Definition
isocitrate dehydrogenase 3 (NAD+) alpha (EC:1.1.1.41)
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hsa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q25.1-q25.2
AA seq 366 aa AA seqDB search
MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAP
IQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR
RVKDLD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcccgcgtggatctctaaggtctctcggctgctgggggcattccacaaccca
aaacaggtgaccagaggttttactggtggtgttcagacagtaactttaattccaggagat
ggtattggcccagaaatttcagctgcagttatgaagatttttgatgctgccaaagcacct
attcagtgggaggagcggaacgtcactgccattcaaggacctggaggaaagtggatgatc
ccttcagaggctaaagagtccatggataagaacaagatgggcttgaaaggccctttgaag
accccaatagcagccggtcacccatctatgaatttactgctgcgcaaaacatttgacctt
tacgcgaatgtccgaccatgtgtctctatcgaaggctataaaaccccttacaccgatgta
aatattgtgaccattcgagagaacacagaaggagaatacagtggaattgagcatgtgatt
gttgatggagtcgtgcagagtatcaagctcatcaccgagggggcgagcaagcgcattgct
gagtttgcctttgagtatgcccggaacaaccaccggagcaacgtcacggcggtgcacaaa
gccaacatcatgcggatgtcagatgggctttttctacaaaaatgcagggaagttgcagaa
agctgtaaagatattaaatttaatgagatgtaccttgatacagtatgtttgaatatggta
caagatccttcccaatttgatgttcttgttatgccaaatttgtatggagacatccttagt
gacttgtgtgcaggattgatcggaggtctcggtgtgacaccaagtggcaacattggagcc
aatggggttgcaatttttgagtcggttcatgggacggctccagacattgcaggcaaggac
atggcgaatcccacagccctcctgctcagtgccgtgatgatgctgcgccacatgggactt
tttgaccatgctgcaagaattgaggctgcgtgttttgctacaattaaggacggaaagagc
ttgacaaaagatttgggaggcaatgcaaaatgctcagacttcacagaggaaatctgtcgc
cgagtaaaagatttagattaa

DBGET integrated database retrieval system