KEGG   Homo sapiens (human): 3421Help
Entry
3421              CDS       T01001                                 

Gene name
IDH3G, H-IDHG
Definition
isocitrate dehydrogenase 3 (NAD+) gamma (EC:1.1.1.41)
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    3421 (IDH3G)
   01210 2-Oxocarboxylic acid metabolism
    3421 (IDH3G)
   01230 Biosynthesis of amino acids
    3421 (IDH3G)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3421 (IDH3G)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     3421 (IDH3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 393 aa AA seqDB search
MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMI
PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaaggtagcgaccgtcgccggcagcgccgcgaaggcggtgctcgggccagcc
cttctctgccgtccctgggaggttctaggcgcccacgaggtcccctcgaggaacatcttt
tcagaacaaacaattcctccgtccgctaagtatggcgggcggcacacggtgaccatgatc
ccaggggatggcatcgggccagagctcatgctgcatgtcaagtccgtcttcaggcacgca
tgtgtaccagtggactttgaagaggtgcacgtgagttccaatgctgatgaagaggacatt
cgcaatgccatcatggccatccgccggaaccgcgtggccctgaagggcaacatcgaaacc
aaccataacctgccaccgtcgcacaaatctcgaaacaacatccttcgcaccagcctggac
ctctatgccaacgtcatccactgtaagagccttccaggcgtggtgacccggcacaaggac
atagacatcctcattgtccgggagaacacagagggcgagtacagcagcctggagcatgag
agtgtggcgggagtggtggagagcctgaagatcatcaccaaggccaagtccctgcgcatt
gccgagtatgccttcaagctggcgcaggagagcgggcgcaagaaagtgacggccgtgcac
aaggccaacatcatgaaactgggcgatgggcttttcctccagtgctgcagggaggtggca
gcccgctaccctcagatcaccttcgagaacatgattgtggataacaccaccatgcagctg
gtgtcccggccccagcagtttgatgtcatggtgatgcccaatctctatggcaacatcgtc
aacaatgtctgcgcgggactggtcgggggcccaggccttgtggctggggccaactatggc
catgtgtacgcggtgtttgaaacagctacgaggaacaccggcaagagtatcgccaataag
aacatcgccaaccccacggccaccctgctggccagctgcatgatgctggaccacctcaag
ctgcactcctatgccacctccatccgtaaggctgtcctggcatccatggacaatgagaat
atgcacactccggacatcgggggccagggcacaacatctgaagccatccaggacgtcatc
cgccacatccgcgtcatcaacggccgggccgtggaggcctag

DBGET integrated database retrieval system