KEGG   Homo sapiens (human): 343Help
Entry
343               CDS       T01001                                 

Gene name
AQP8, AQP-8
Definition
aquaporin 8
Orthology
K09869  
aquaporin-8
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    343 (AQP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12
AA seq 261 aa AA seqDB search
MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENG
TDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLG
GMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEK
TKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLL
VGLLIRCFIGDGKTRLILKAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagagatagccatgtgtgagcctgaatttggcaatgacaaggccagggagccg
agcgtgggtggcaggtggcgagtgtcctggtacgaacggtttgtgcagccatgtctggtc
gaactgctgggctctgctctcttcatcttcatcgggtgcctgtcggtcattgagaatggg
acggacactgggctgctgcagccggccctggcccacgggctggctttggggctcgtgatt
gccacgctggggaatatcagtggtggacacttcaaccctgcggtgtccctggcagccatg
ctgatcggaggcctcaacctggtgatgctcctcccgtactgggtctcacagctgctcggg
gggatgctcggggctgccttggccaaggcggtgagtcctgaggagaggttctggaatgca
tctggggcggcctttgtgacagtccaggagcaggggcaggtggcaggggcgttggtggca
gagatcatcctgacgacgctgctggccctggctgtatgcatgggtgccatcaatgagaag
acaaagggccctctggccccgttctccatcggctttgccgtcaccgtggatatcctggct
gggggccctgtgtctggaggctgcatgaatcccgcccgtgcttttggacctgcggtggtg
gccaaccactggaacttccactggatctactggctgggcccactcctggctggcctgctt
gttggactgctcattaggtgcttcattggagatgggaagacccgcctcatcctgaaggct
cggtga

DBGET integrated database retrieval system