KEGG   Homo sapiens (human): 343Help
Entry
343               CDS       T01001                                 

Gene name
AQP8, AQP-8
Definition
(RefSeq) aquaporin 8
  KO
K09869  aquaporin-8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    343 (AQP8)
Transporters [BR:hsa02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    343 (AQP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 343
NCBI-ProteinID: NP_001160
OMIM: 603750
HGNC: 642
Ensembl: ENSG00000103375
Vega: OTTHUMG00000097013
Pharos: O94778(Tbio)
UniProt: O94778
Position
16p12.1
AA seq 261 aa AA seqDB search
MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENG
TDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLG
GMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEK
TKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLL
VGLLIRCFIGDGKTRLILKAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagagatagccatgtgtgagcctgaatttggcaatgacaaggccagggagccg
agcgtgggtggcaggtggcgagtgtcctggtacgaacggtttgtgcagccatgtctggtc
gaactgctgggctctgctctcttcatcttcatcgggtgcctgtcggtcattgagaatggg
acggacactgggctgctgcagccggccctggcccacgggctggctttggggctcgtgatt
gccacgctggggaatatcagtggtggacacttcaaccctgcggtgtccctggcagccatg
ctgatcggaggcctcaacctggtgatgctcctcccgtactgggtctcacagctgctcggg
gggatgctcggggctgccttggccaaggcggtgagtcctgaggagaggttctggaatgca
tctggggcggcctttgtgacagtccaggagcaggggcaggtggcaggggcgttggtggca
gagatcatcctgacgacgctgctggccctggctgtatgcatgggtgccatcaatgagaag
acaaagggccctctggccccgttctccatcggctttgccgtcaccgtggatatcctggct
gggggccctgtgtctggaggctgcatgaatcccgcccgtgcttttggacctgcggtggtg
gccaaccactggaacttccactggatctactggctgggcccactcctggctggcctgctt
gttggactgctcattaggtgcttcattggagatgggaagacccgcctcatcctgaaggct
cggtga

DBGET integrated database retrieval system