KEGG   Homo sapiens (human): 3434Help
Entry
3434              CDS       T01001                                 

Gene name
IFIT1, C56, G10P1, IFI-56, IFI-56K, IFI56, IFIT-1, IFNAI1, ISG56, P56, RNM561
Definition
interferon-induced protein with tetratricopeptide repeats 1
Orthology
K14217  
interferon-induced protein with tetratricopeptide repeats 1
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis C
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.31
AA seq 478 aa AA seqDB search
MCTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacaaatggtgatgatcatcaggtcaaggatagtctggagcaattgagatgtcac
tttacatgggagttatccattgatgacgatgaaatgcctgatttagaaaacagagtcttg
gatcagattgaattcctagacaccaaatacagtgtgggaatacacaacctactagcctat
gtgaaacacctgaaaggccagaatgaggaagccctgaagagcttaaaagaagctgaaaac
ttaatgcaggaagaacatgacaaccaagcaaatgtgaggagtctggtgacctggggcaac
tttgcctggatgtattaccacatgggcagactggcagaagcccagacttacctggacaag
gtggagaacatttgcaagaagctttcaaatcccttccgctatagaatggagtgtccagaa
atagactgtgaggaaggatgggccttgctgaagtgtggaggaaaaaattatgaacgggcc
aaggcctgctttgaaaaggtgcttgaagtggaccctgaaaaccctgaatccagcgctggg
tatgcgatctctgcctatcgcctggatggctttaaattagccacaaaaaatcacaagcca
ttttctttgcttcccctaaggcaggctgtccgcttaaatccagacaatggatatattaag
gttctccttgccctgaagcttcaggatgaaggacaggaagctgaaggagaaaagtacatt
gaagaagctctagccaacatgtcctcacagacctatgtctttcgatatgcagccaagttt
taccgaagaaaaggctctgtggataaagctcttgagttattaaaaaaggccttgcaggaa
acacccacttctgtcttactgcatcaccagatagggctttgctacaaggcacaaatgatc
caaatcaaggaggctacaaaagggcagcctagagggcagaacagagaaaagctagacaaa
atgataagatcagccatatttcattttgaatctgcagtggaaaaaaagcccacatttgag
gtggctcatctagacctggcaagaatgtatatagaagcaggcaatcacagaaaagctgaa
gagaattttcaaaaattgttatgcatgaaaccagtggtagaagaaacaatgcaagacata
catttccactatggtcggtttcaggaatttcaaaagaaatctgacgtcaatgcaattatc
cattatttaaaagctataaaaatagaacaggcatcattaacaagggataaaagtatcaat
tctttgaagaaattggttttaaggaaacttcggagaaaggcattagatctggaaagcttg
agcctccttgggttcgtctacaaattggaaggaaatatgaatgaagccctggagtactat
gagcgggccctgagactggctgctgactttgagaactctgtgagacaaggtccttag

DBGET integrated database retrieval system