KEGG   Homo sapiens (human): 343563Help
Entry
343563            CDS       T01001                                 

Gene name
OR2T29
Definition
olfactory receptor, family 2, subfamily T, member 29
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    343563 (OR2T29)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    343563 (OR2T29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 315 aa AA seqDB search
MANITRMANHTGRLDFILMGLFRQSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH
SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA
TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH
FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK
AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD
VMGALKKMLTVRFVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcaccaggatggccaaccacactggaaggttggatttcatcctcatggga
ctcttcagacaatccaaacatccagctctacttagtgtggtcatctttgtggttttcctg
aaggcgttgtctggaaatgctgtcctgatccttctgatacactgtgacgcccacctccac
agccccatgtactttttcatcagtcaattgtctctcatggacatggcgtacatttctgtc
actgtgcccaagatgctcctggaccaggtcatgggtgtgaataaggtctcagcccctgag
tgtgggatgcagatgttcctctatctgacactagcaggttcggaatttttccttctagcc
accatggcctatgaccgctacgtggccatctgccatcctctccgttaccctgtcctcatg
aaccatagggtctgtcttttcctggcatcgggctgctggttcctgggctcagtggatggc
ttcatgctcactcccatcaccatgagcttccccttctgcagatcctgggagattcatcat
ttcttctgtgaagtccctgctgtaacgatcctgtcctgctcagacacctcactctatgag
accctcatgtacctatgctgtgtcctcatgctcctcatccctgtgacgatcatttcaagc
tcctatttactcatcctcctcaccgtccacaggatgaactcagcagagggccggaaaaag
gcctttgccacctgctcctcccacctgactgtggtcatcctcttctatggggctgccgtc
tacacctacatgctccccagctcctaccacacccctgagaaggacatgatggtatctgtc
ttctataccatcctcactccggtgctgaaccctttaatctatagtcttaggaataaggat
gtcatgggggctctgaagaaaatgttaactgtgagattcgtcctttag

DBGET integrated database retrieval system