KEGG   Homo sapiens (human): 343563Help
Entry
343563            CDS       T01001                                 

Gene name
OR2T29
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 29
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    343563 (OR2T29)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    343563 (OR2T29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 343563
NCBI-ProteinID: NP_001004694
HGNC: 31253
Ensembl: ENSG00000182783
Vega: OTTHUMG00000040382
Pharos: Q8NH02(Tdark)
UniProt: Q8NH02
Position
1q44
AA seq 315 aa AA seqDB search
MANITRMANHTGRLDFILMGLFRQSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH
SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA
TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH
FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK
AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD
VMGALKKMLTVRFVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcaccaggatggccaaccacactggaaggttggatttcatcctcatggga
ctcttcagacaatccaaacatccagctctacttagtgtggtcatctttgtggttttcctg
aaggcgttgtctggaaatgctgtcctgatccttctgatacactgtgacgcccacctccac
agccccatgtactttttcatcagtcaattgtctctcatggacatggcgtacatttctgtc
actgtgcccaagatgctcctggaccaggtcatgggtgtgaataaggtctcagcccctgag
tgtgggatgcagatgttcctctatctgacactagcaggttcggaatttttccttctagcc
accatggcctatgaccgctacgtggccatctgccatcctctccgttaccctgtcctcatg
aaccatagggtctgtcttttcctggcatcgggctgctggttcctgggctcagtggatggc
ttcatgctcactcccatcaccatgagcttccccttctgcagatcctgggagattcatcat
ttcttctgtgaagtccctgctgtaacgatcctgtcctgctcagacacctcactctatgag
accctcatgtacctatgctgtgtcctcatgctcctcatccctgtgacgatcatttcaagc
tcctatttactcatcctcctcaccgtccacaggatgaactcagcagagggccggaaaaag
gcctttgccacctgctcctcccacctgactgtggtcatcctcttctatggggctgccgtc
tacacctacatgctccccagctcctaccacacccctgagaaggacatgatggtatctgtc
ttctataccatcctcactccggtgctgaaccctttaatctatagtcttaggaataaggat
gtcatgggggctctgaagaaaatgttaactgtgagattcgtcctttag

DBGET integrated database retrieval system