KEGG   Homo sapiens (human): 3445Help
Entry
3445              CDS       T01001                                 

Gene name
IFNA8, IFN-alphaB
Definition
interferon, alpha 8
Orthology
K05414  
interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Regulation of autophagy
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Autoimmune thyroid disease
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3445 (IFNA8)
   04151 PI3K-Akt signaling pathway
    3445 (IFNA8)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3445 (IFNA8)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    3445 (IFNA8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3445 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    3445 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    3445 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    3445 (IFNA8)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    3445 (IFNA8)
  Infectious diseases
   05152 Tuberculosis
    3445 (IFNA8)
   05162 Measles
    3445 (IFNA8)
   05164 Influenza A
    3445 (IFNA8)
   05161 Hepatitis B
    3445 (IFNA8)
   05160 Hepatitis C
    3445 (IFNA8)
   05168 Herpes simplex infection
    3445 (IFNA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p22
AA seq 189 aa AA seqDB search
MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE
FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE
SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc
tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttgatactc
ctggcacaaatgcgaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgctttg
gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgatagagtctcccctgatgtacgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctatatctgacagagaagaaatacagc
tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaatga

DBGET integrated database retrieval system