KEGG   Homo sapiens (human): 3447Help
Entry
3447              CDS       T01001                                 

Gene name
IFNA13
Definition
interferon, alpha 13
Orthology
K05414  
interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Regulation of autophagy
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Autoimmune thyroid disease
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:hsa04140]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p22
AA seq 190 aa AA seqDB search
MMASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDF
GFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL
EACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLST
NLQERLRRKE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctcgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagc
tgctctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatg
ctcctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgacttt
ggatttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgct
tgggatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttg
gaagcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactcc
atcttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaaca
aacttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system