KEGG   Homo sapiens (human): 344752Help
Entry
344752            CDS       T01001                                 

Gene name
AADACL2
Definition
(RefSeq) arylacetamide deacetylase-like 2
  KO
K14350  
arylacetamide deacetylase-like 2 [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     344752 (AADACL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.1
AA seq 401 aa AA seqDB search
MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEE
FISMIFRLDYTQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSS
KQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDP
TRICIAGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGLQITDSYLPSHRENEHGIV
LTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEP
ILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQ
VVHEHIEDGIHGALSFMTSPFYLRLGLRIRDMYVSWLDKNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggggctaaaagctctctgtttggggctgctttgtgttctttttgtctctcatttttac
acacccatgccagacaacattgaagaaagctggaaaataatggccttggatgccatcgct
aaaacttgtacatttacggctatgtgttttgaaaatatgcgtattatgagatatgaagag
tttatatccatgatattcaggctggattatacccaaccactttcagatgaatacatcaca
gtgactgatacaacatttgttgacattccagtacgattgtacttgccaaaaagaaagtca
gaaacccgaaggcgagctgtgatatattttcatggtggtggtttttgttttggaagttcc
aaacagagggcttttgacttcctgaatagatggacggcaaacacgcttgatgctgttgtt
gtaggcgtggactataggctggctcctcaacaccactttcctgctcagtttgaagatggc
cttgctgcagtcaaattttttcttttggaaaaaattcttacaaaatatggagtggatccc
acccgaatctgcattgcgggagacagttctgggggcaatttagcaacagcggtcactcaa
caggtgcagaatgatgctgaaataaaacataaaatcaagatgcaagtcttactttaccct
ggcttacagataacagattcttatttgccatctcaccgagaaaatgagcatggtatagtt
ttgaccagggatgtagccataaaactcgtgagcttatatttcaccaaggatgaagcactt
ccctgggcaatgagaagaaaccaacacatgcctctggagtcaagacatctgtttaagttt
gttaactggagtattcttcttcctgagaagtatagaaaagactatgtatatactgaacca
attcttggaggacttagttattcattgccaggacttacagacagcagagcattacccttg
ttggccaatgattctcagttacagaatttgccactaacctatattcttacttgtcaacat
gatctcttaagagatgatggacttatgtatgttacaagacttcgaaatgttggagtccaa
gttgttcatgaacatattgaggatggaattcatggagctttatcattcatgacttcacca
ttttatttacgtctaggtcttaggataagagatatgtatgtaagttggctggataagaat
ttataa

DBGET integrated database retrieval system