KEGG   Homo sapiens (human): 344758Help
Entry
344758            CDS       T01001                                 

Gene name
GPR149, IEDA, PGR10
Definition
(RefSeq) G protein-coupled receptor 149
  KO
K08433  
G protein-coupled receptor 149
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    344758 (GPR149)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.2
AA seq 731 aa AA seqDB search
MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLK
MQNRTVVSMLVASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSN
LKATLLVSYNFYTMHRGVGSQTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPW
GCLVDCSSSYVLFLSIVYALAFGLLVGLSVPLTHRLLCSEEPPRLHSNYQEISRGASIPG
TPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAPAAAGAEACRRENRGTLYGTR
SFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLLTLLATTVTPV
FVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDD
DENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITE
AKQDSNNKKDAFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPR
QRSGYALAIPLCAFQGTVSLHAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHE
PNSEDSSSTFVDTSVKIHLEVLEICDNEEALDTVSIISNISQSSTQVRSPSLRYSRKENR
FVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNSKRQHQERDGYQEEIQLLNKA
YRKREEESKGS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatttctcagtaacttatcaacaaatgactctagcctgtggaaagagaatcat
aattctacggaccttttaaatccgccaggaaccctgaatatctatcttttttgcttgaca
tgtctcatgacttttgcagccttggtgggcagcatttattcactaatttccctgctgaaa
atgcagaacagaactgttgtgtccatgcttgtggcttcctggtctgtggatgatctcatg
agcgtcctgtcggtgaccatcttcatgtttttgcagtggccaaacgaggtccccggttac
ttccaatttctgtgcaccacctctgccttaatgtatttatgccagggcctctctagcaac
ttgaaggcgactctcctagtctcttacaacttttatacgatgcacagaggtgtggggagc
cagacagcctccagaagatcgggccaggtgctcggcgtggtgctgaccgtgtgggcagcc
agtctgctgctctcggcgctcccgctgtgcggctggggcgccttcgtgcgcacgccctgg
ggctgcctggtggactgctccagctcctacgtactattcctctctatcgtgtacgctttg
gccttcggactcctcgtgggcctctcagtcccactcactcaccgattgctgtgttcggag
gagccgccgagactccactccaactaccaggaaatttcccgtggagcttcaattcctggg
acccctcctactgcggggagagtggtttccctgtccccagaggatgctccaggcccgagt
ctgcggcgctctgggggatgctctccgagctccgacaccgtgttcggaccgggtgcgccc
gctgccgctggggctgaagcctgcaggcgtgagaaccgggggactctctatggcaccagg
agcttcaccgtgagcgtagcgcagaagcgcttcgctttgatcctagcgcttacaaaagtc
gtcctttggctgcccatgatgatgcacatggtggtccagaacgtcgtggggtttcagagc
cttcccttggagacattcagctttctacttaccctgctggccaccactgtaaccccagtg
tttgtcttgtccaaacgctggacccacttgccctgtggctgcatcatcaactgcaggcag
aacgcatatgcagtggcgtccgatgggaaaaaaatcaagagaaaaggctttgaattcaat
ctatcattccaaaaaagttatgggatttataaaatagcacatgaagattactatgatgat
gatgaaaattccatattctatcacaacctgatgaactctgagtgtgaaactacaaaagac
cctcagagagacaaccgtaacatcttcaatgctataaaagtagaaatcagcaccacgccc
tctctggacagctccacacaaagaggcatcaacaaatgcacaaatactgatattacagaa
gctaaacaggattccaacaacaaaaaggatgcgttttctgacaaaacaggaggtgatatt
aactatgaagaaactaccttttctgaagggccagaaagaagactgtctcatgaagagagt
cagaaaccagatctttcagactgggagtggtgtaggagtaaatcagaaagaacccctcgt
cagcgttccggttatgcccttgccattcccttgtgtgcattccaggggactgtgtctctc
catgcacctacagggaaaaccctatctctttctacctatgaggtaagcgcagaagggcaa
aaaataactccagcctctaagaaaatagaagtctatcgatccaaaagtgttggccatgaa
ccaaactcagaagattcttcatccacgtttgtggacaccagtgtgaaaatacacttggag
gttcttgaaatttgtgataatgaagaggccttggacactgtgtcaatcattagtaacatc
agtcagtcctccacacaagtcagatctccatccctacgttactccaggaaagaaaacaga
tttgtttcatgtgacctaggggaaacagcctcatactccctctttttgcccaccagtaat
cctgatggtgatattaatatctccattccagacacagtagaagcacacaggcagaacagt
aaaaggcagcatcaagagagggatggctaccaggaggaaatccagttgttaaataaagct
tacagaaaaagagaggaagaaagcaagggtagttag

DBGET integrated database retrieval system