KEGG   Homo sapiens (human): 345Help
Entry
345               CDS       T01001                                 

Gene name
APOC3, APOCIII, HALP2
Definition
apolipoprotein C-III
Orthology
K08759  
apolipoprotein C-III
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Disease
H01199  
Hyperalphalipoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    345 (APOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 99 aa AA seqDB search
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccgggtactccttgttgttgccctcctggcgctcctggcctctgcccgagct
tcagaggccgaggatgcctcccttctcagcttcatgcagggttacatgaagcacgccacc
aagaccgccaaggatgcactgagcagcgtgcaggagtcccaggtggcccagcaggccagg
ggctgggtgaccgatggcttcagttccctgaaagactactggagcaccgttaaggacaag
ttctctgagttctgggatttggaccctgaggtcagaccaacttcagccgtggctgcctga

DBGET integrated database retrieval system