KEGG   Homo sapiens (human): 345456Help
Entry
345456            CDS       T01001                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    345456 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    345456 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    345456 (PFN3)
   05131 Shigellosis
    345456 (PFN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   345456 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg
caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc
ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system