KEGG   Homo sapiens (human): 345456Help
Entry
345456            CDS       T01001                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Shigellosis
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg
caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc
ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system