KEGG   Homo sapiens (human): 3455Help
Entry
3455              CDS       T01001                                 

Gene name
IFNAR2, IFN-R, IFN-alpha-REC, IFNABR, IFNARB
Definition
interferon (alpha, beta and omega) receptor 2
Orthology
K05131  
interferon receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Drug target
Interferon alfa natural: 
Interferon beta natural: 
Interferon alfa-2a: 
Interferon alfa-2b: 
Interferon alfa-n1: 
Interferon beta-1a: 
Interferon beta-1b: 
Interferon alfacon-1: 
Peginterferon alfa-2b: 
Peginterferon alfa-2a: 
Albinterferon alfa-2b: 
Peginterferon beta-1a: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3455 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    3455 (IFNAR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3455 (IFNAR2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    3455 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    3455 (IFNAR2)
  Development
   04380 Osteoclast differentiation
    3455 (IFNAR2)
 Human Diseases
  Infectious diseases
   05162 Measles
    3455 (IFNAR2)
   05164 Influenza A
    3455 (IFNAR2)
   05160 Hepatitis C
    3455 (IFNAR2)
   05168 Herpes simplex infection
    3455 (IFNAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 331 aa AA seqDB search
MLLSQNAFIFRSLNLVLMVYISLVFGISYDSPDYTDESCTFKISLRNFRSILSWELKNHS
IVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLF
SCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKK
HKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAE
SAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLAKGWNAVAIHRCSHNA
LQSETPELKQSSCLSFPSSWDYKRASLCPSD
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcttttgagccagaatgccttcatcttcagatcacttaatttggttctcatggtgtat
atcagcctcgtgtttggtatttcatatgattcgcctgattacacagatgaatcttgcact
ttcaagatatcattgcgaaatttccggtccatcttatcatgggaattaaaaaaccactcc
attgtaccaactcactatacattgctgtatacaatcatgagtaaaccagaagatttgaag
gtggttaagaactgtgcaaataccacaagatcattttgtgacctcacagatgagtggaga
agcacacacgaggcctatgtcaccgtcctagaaggattcagcgggaacacaacgttgttc
agttgctcacacaatttctggctggccatagacatgtcttttgaaccaccagagtttgag
attgttggttttaccaaccacattaatgtgatggtgaaatttccatctattgttgaggaa
gaattacagtttgatttatctctcgtcattgaagaacagtcagagggaattgttaagaag
cataaacccgaaataaaaggaaacatgagtggaaatttcacctatatcattgacaagtta
attccaaacacgaactactgtgtatctgtttatttagagcacagtgatgagcaagcagta
ataaagtctcccttaaaatgcaccctccttccacctggccaggaatcagaatcagcagaa
tctgccaaaataggaggaataattactgtgtttttgatagcattggtcttgacaagcacc
atagtgacactgaaatggattggttatatatgcttaagaaatagcctccccaaagtcttg
aggcaaggtctcgctaagggctggaatgcagtggctattcacaggtgcagtcataatgca
ctacagtctgaaactcctgagctcaaacagtcgtcctgcctaagcttccccagtagctgg
gattacaagcgtgcatccctgtgccccagtgattaa

DBGET integrated database retrieval system