KEGG   Homo sapiens (human): 345611Help
Entry
345611            CDS       T01001                                 

Gene name
IRGM, IFI1, IRGM1, LRG-47, LRG47
Definition
immunity-related GTPase family, M
Orthology
K14139  
immunity-related GTPase family M protein [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    345611 (IRGM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     345611 (IRGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.1
AA seq 181 aa AA seqDB search
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEG
KASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVAS
AQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCE
Y
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatgaatgttgagaaagcctcagcagatgggaacttgccagaggtgatctct
aacatcaaggagactctgaagatagtgtccaggacaccagttaacatcactatggcaggg
gactctggcaatgggatgtccaccttcatcagtgcccttcgaaacacaggacatgagggt
aaggcctcacctcctactgagctggtaaaagctacccaaagatgtgcctcctatttctct
tcccacttttcaaatgtggtgttgtgggacctgcctggcacagggtctgccaccacaacc
ctggagaactacctgatggaaatgcagttcaaccggtatgacttcatcatggttgcatct
gcacaattcagcatgaatcatgtgatgcttgccaaaaccgctgaggacatgggaaagaag
ttctacattgtctggaccaagctagacatggacctcagcacaggtgccctcccagaagtg
cagctactgcagatcagagaaaatgtcctggaaaatctccagaaggagcgggtatgtgaa
tactaa

DBGET integrated database retrieval system