KEGG   Homo sapiens (human): 3459Help
Entry
3459              CDS       T01001                                 

Gene name
IFNGR1, CD119, IFNGR
Definition
interferon gamma receptor 1
Orthology
K05132  
interferon gamma receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Osteoclast differentiation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Inflammatory bowel disease (IBD)
Disease
H00089  
IFN-gamma/IL-12 axis
H00342  
Tuberculosis
Drug target
Interferon gamma: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3459 (IFNGR1)
   04066 HIF-1 signaling pathway
    3459 (IFNGR1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3459 (IFNGR1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3459 (IFNGR1)
  Development
   04380 Osteoclast differentiation
    3459 (IFNGR1)
 Human Diseases
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3459 (IFNGR1)
  Infectious diseases
   05132 Salmonella infection
    3459 (IFNGR1)
   05152 Tuberculosis
    3459 (IFNGR1)
   05162 Measles
    3459 (IFNGR1)
   05164 Influenza A
    3459 (IFNGR1)
   05168 Herpes simplex infection
    3459 (IFNGR1)
   05145 Toxoplasmosis
    3459 (IFNGR1)
   05140 Leishmaniasis
    3459 (IFNGR1)
   05142 Chagas disease (American trypanosomiasis)
    3459 (IFNGR1)
Cellular antigens [BR:hsa04090]
 Proteins
  3459 (IFNGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q23.3
AA seq 489 aa AA seqDB search
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctctttctcctaccccttgtcatgcagggtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctacaccaactaatgttacaattgaatcctat
aacatgaaccctatcgtatattgggagtaccagatcatgccacaggtccctgtttttacc
gtagaggtaaagaactatggtgttaagaattcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcagaagaatttgct
gtatgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacatatttcacccttcagtttttgtaaatggagacgagcaggaagtcgat
tatgatcccgaaactacctgttacattagggtgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgtgacgagattcagtgc
cagttagcgattccagtatcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtgtggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagtataaaaggttctctttggattccagttgttgctgctttactactctttctagtg
cttagcctggtattcatctgtttttatattaagaaaattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacgtcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtggaacatacagaagaactttctagtataacagaagtggtgactactgaagaa
aatattcctgacgtggtcccgggcagccatctgactccaatagagagagagagttcttca
cctttaagtagtaaccagtctgaacctggcagcatcgctttaaactcgtatcactccaga
aattgttctgagagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacatagctccttatctgactcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataaccgtaataaaagcccccacctcctttggttatgataaacca
catgtgctagtggatctacttgtggatgatagcggtaaagagtccttgattggttataga
ccaacagaagattccaaagaattttcatga

DBGET integrated database retrieval system