KEGG   Homo sapiens (human): 3459Help
Entry
3459              CDS       T01001                                 

Gene name
IFNGR1, CD119, IFNGR, IMD27A, IMD27B
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05132  Salmonella infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00185  KSHV MIR2 to cell surface molecule-endocytosis
N00210  KSHV MIR1/2 to host-cell-protein inhibition
Disease
H00089  IFN-gamma/IL-12 axis
H00342  Tuberculosis
Drug target
Interferon gamma (DG00737): D00747 D03357 D08805
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3459 (IFNGR1)
   04066 HIF-1 signaling pathway
    3459 (IFNGR1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3459 (IFNGR1)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    3459 (IFNGR1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    3459 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    3459 (IFNGR1)
   04659 Th17 cell differentiation
    3459 (IFNGR1)
  Development
   04380 Osteoclast differentiation
    3459 (IFNGR1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3459 (IFNGR1)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3459 (IFNGR1)
  Infectious diseases
   05132 Salmonella infection
    3459 (IFNGR1)
   05152 Tuberculosis
    3459 (IFNGR1)
   05162 Measles
    3459 (IFNGR1)
   05164 Influenza A
    3459 (IFNGR1)
   05168 Herpes simplex infection
    3459 (IFNGR1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    3459 (IFNGR1)
   05145 Toxoplasmosis
    3459 (IFNGR1)
   05140 Leishmaniasis
    3459 (IFNGR1)
   05142 Chagas disease (American trypanosomiasis)
    3459 (IFNGR1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IFN receptor family
   3459 (IFNGR1)
CD molecules [BR:hsa04090]
 Proteins
  3459 (IFNGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 3459
NCBI-ProteinID: NP_000407
OMIM: 107470
HGNC: 5439
Ensembl: ENSG00000027697
Vega: OTTHUMG00000015656
Pharos: P15260(Tbio)
UniProt: P15260 A0A0S2Z3Y2
Structure
PDB: 

Jmol
Position
6q23.3
AA seq 489 aa AA seqDB search
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctctttctcctaccccttgtcatgcagggtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctacaccaactaatgttacaattgaatcctat
aacatgaaccctatcgtatattgggagtaccagatcatgccacaggtccctgtttttacc
gtagaggtaaagaactatggtgttaagaattcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcagaagaatttgct
gtatgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacatatttcacccttcagtttttgtaaatggagacgagcaggaagtcgat
tatgatcccgaaactacctgttacattagggtgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgtgacgagattcagtgc
cagttagcgattccagtatcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtgtggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagtataaaaggttctctttggattccagttgttgctgctttactactctttctagtg
cttagcctggtattcatctgtttttatattaagaaaattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacgtcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtggaacatacagaagaactttctagtataacagaagtggtgactactgaagaa
aatattcctgacgtggtcccgggcagccatctgactccaatagagagagagagttcttca
cctttaagtagtaaccagtctgaacctggcagcatcgctttaaactcgtatcactccaga
aattgttctgagagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacatagctccttatctgactcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataaccgtaataaaagcccccacctcctttggttatgataaacca
catgtgctagtggatctacttgtggatgatagcggtaaagagtccttgattggttataga
ccaacagaagattccaaagaattttcatga

DBGET integrated database retrieval system