KEGG   Homo sapiens (human): 346171Help
Entry
346171            CDS       T01001                                 

Gene name
ZFP57, C6orf40, TNDM1, ZNF698, bA145L22, bA145L22.2
Definition
ZFP57 zinc finger protein
Orthology
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Disease
H00513  
Transient neonatal diabetes mellitus (TNDM)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.1
AA seq 536 aa AA seqDB search
MFEQLKPIEPVQKTLPWVGEVAATLQEAMKRDCWREARVKKKPVTFEDVAVNFTQEEWDC
LDASQRVLYQDVMSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGK
KKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTC
GKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTY
CDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGT
QAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAP
ITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKS
FSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILG
QWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacagctgaagccaatcgaacctgtacagaagacgctcccatgggtgggcgag
gtagctgccaccctgcaggaagccatgaagagagattgctggagggaggcacgggtgaag
aagaagccagtcacctttgaggatgtggcagtgaatttcacccaggaagagtgggactgt
ctagatgccagccagagggtcctttaccaggatgttatgtcggaaacctttaagaatcta
acatctgtggccagaatctttctgcataagccagagctaatcaccaagcttgagcaagaa
gaggaacagtggagagagtttgtccatctcccaaacacagaaggcctttcagaaggcaag
aagaaagagcttcgagaacaacatcccagtctgagagatgaggggactagtgatgacaag
gtcttccttgcatgcagaggggccggccagtgccccctatctgccccagctgggactatg
gacaggacccgggtgcttcaagcatcccaggctgggccaccctttttttgctacacctgt
ggcaaatgtttcagcaggcgctcctacctctatagccaccagtttgttcacaatcccaag
ctgactaacagctgcagtcagtgtgggaagttgtttcggagccccaagtccctcagctat
cacagacgcatgcatcttggggagaggcccttctgttgcacgctctgtgacaagacctac
tgtgatgcttctggactaagtcgtcaccgccgcgtccatctgggttaccggccccattca
tgctctgtgtgtgggaagagcttccgggaccagtctgagctcaaacgccaccagaagata
caccaaaaccaggagccagtggatggaaaccaggagtgtactttgaggattccaggcacc
caggctgaattccagacacccatcgccagaagccagaggtccatccaggggcttttggat
gtgaaccatgcaccagtggccaggtcccaggaacccatatttagaactgagggtcctatg
gcccagaaccaggcatctgtacttaagaaccaagcacctgtgaccaggacccaggcaccc
atcactggaaccctctgtcaggatgccagatccaactctcatccagtgaagccctcaaga
ctcaatgtcttctgttgcccccattgttctttgacttttagcaagaaatcctatctctcc
agacaccagaaggcccacctcacagagccgcccaactactgcttccattgcagcaagtct
ttcagctcattttccaggctggtcagacaccagcagacccactggaagcagaagagctac
ctttgccctatctgtgacctctcctttggggagaaagagggccttatggatcactggagg
ggctataaaggcaaggacctgtgccagagcagccaccataaatgccgggtgatcctgggc
cagtggcttggcttctctcatgatgtccccactatggctggggaggaatggaagcatgga
ggtgatcaatctccccccaggatccatacccccaggagaagaggcctaagagagaaggcc
tgcaaaggagacaaaacaaaggaggcagtgagcatcttgaaacataaataa

DBGET integrated database retrieval system