KEGG   Homo sapiens (human): 346525Help
Entry
346525            CDS       T01001                                 

Gene name
OR2A12, OR2A12P, OR2A16P
Definition
(RefSeq) olfactory receptor family 2 subfamily A member 12
  KO
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    346525 (OR2A12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    346525 (OR2A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 310 aa AA seqDB search
MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYV
FLSHLAIVDMSYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYD
RYVAICHPLQYTLIMNWRVCTVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQI
MSVFKLACADTRLNQVVLFAGSAFILVGPLCLVLVSYLHILVAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLFNPILNPLIYSLRNAEVKGAL
KRVLWKQRSM
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaatcagacctggatcacagaagtcatcctgttgggattccaggtggaccca
gctctggagttgttcctctttgggtttttcttgctattctacagcttaaccctgatggga
aatgggattatcctggggctcatctacttggactctagactgcacacacccatgtatgtc
ttcctgtcacacctggccattgtggacatgtcctatgcctcgagtactgtccctaagatg
ctagcaaatcttgtgatgcacaaaaaagtcatctcctttgctccttgcatacttcagact
tttttgtatttggcgtttgctattacagagtgtctgattttggtgatgatgtgctatgat
cggtatgtggcaatctgtcaccccttgcaatacaccctcattatgaactggagagtgtgc
actgtcctggcctcaacttgctggatatttagctttctcttggctctggtccatattact
cttattctgaggctgcctttttgtggcccacaaaagatcaaccactttttctgtcaaatc
atgtccgtattcaaattggcctgtgctgacactaggctcaaccaggtggtcctatttgcg
ggttctgcgttcatcttagtggggccgctctgcctggtgctggtctcctacttgcacatc
ctggtggccatcttgaggatccagtctggggagggccgcagaaaggccttctctacctgc
tcctcccacctctgcgtggtggggcttttctttggcagcgccattgtcatgtacatggcc
cccaagtcaagccattctcaagaacggaggaagatcctttccctgttttacagccttttc
aacccgatcctgaaccccctcatctacagccttaggaatgcagaggtgaaaggggctcta
aagagagtcctttggaaacagagatcaatgtga

DBGET integrated database retrieval system