KEGG   Homo sapiens (human): 346525Help
Entry
346525            CDS       T01001                                 

Gene name
OR2A12, OR2A12P, OR2A16P
Definition
olfactory receptor, family 2, subfamily A, member 12
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    346525 (OR2A12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    346525 (OR2A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 310 aa AA seqDB search
MESNQTWITEVILLGFQVDPALELFLFGFFLLFYSLTLMGNGIILGLIYLDSRLHTPMYV
FLSHLAIVDMSYASSTVPKMLANLVMHKKVISFAPCILQTFLYLAFAITECLILVMMCYD
RYVAICHPLQYTLIMNWRVCTVLASTCWIFSFLLALVHITLILRLPFCGPQKINHFFCQI
MSVFKLACADTRLNQVVLFAGSAFILVGPLCLVLVSYLHILVAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSSHSQERRKILSLFYSLFNPILNPLIYSLRNAEVKGAL
KRVLWKQRSM
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaatcagacctggatcacagaagtcatcctgttgggattccaggtggaccca
gctctggagttgttcctctttgggtttttcttgctattctacagcttaaccctgatggga
aatgggattatcctggggctcatctacttggactctagactgcacacacccatgtatgtc
ttcctgtcacacctggccattgtggacatgtcctatgcctcgagtactgtccctaagatg
ctagcaaatcttgtgatgcacaaaaaagtcatctcctttgctccttgcatacttcagact
tttttgtatttggcgtttgctattacagagtgtctgattttggtgatgatgtgctatgat
cggtatgtggcaatctgtcaccccttgcaatacaccctcattatgaactggagagtgtgc
actgtcctggcctcaacttgctggatatttagctttctcttggctctggtccatattact
cttattctgaggctgcctttttgtggcccacaaaagatcaaccactttttctgtcaaatc
atgtccgtattcaaattggcctgtgctgacactaggctcaaccaggtggtcctatttgcg
ggttctgcgttcatcttagtggggccgctctgcctggtgctggtctcctacttgcacatc
ctggtggccatcttgaggatccagtctggggagggccgcagaaaggccttctctacctgc
tcctcccacctctgcgtggtggggcttttctttggcagcgccattgtcatgtacatggcc
cccaagtcaagccattctcaagaacggaggaagatcctttccctgttttacagccttttc
aacccgatcctgaaccccctcatctacagccttaggaatgcagaggtgaaaggggctcta
aagagagtcctttggaaacagagatcaatgtga

DBGET integrated database retrieval system