KEGG   Homo sapiens (human): 346562Help
Entry
346562            CDS       T01001                                 

Gene name
GNAT3, GDCA
Definition
guanine nucleotide binding protein, alpha transducing 3 (EC:2.3.1.4)
Orthology
K04631  
guanine nucleotide-binding protein G(t) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Phototransduction
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    346562 (GNAT3)
  Sensory system
   04744 Phototransduction
    346562 (GNAT3)
   04742 Taste transduction
    346562 (GNAT3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    346562 (GNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.11
AA seq 354 aa AA seqDB search
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMT
PQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggaattagttcagagagcaaggagtcagccaaaagatcaaaagaactggag
aaaaagcttcaggaggatgctgagcgagatgcaagaaccgtaaagctgctactattagga
gcaggagaatctgggaaaagtactattgttaaacaaatgaagatcatccataagaatggt
tacagtgagcaagaatgcatggagttcaaagcagtaatttacagtaatacattgcaatcc
atcctagctattgtgaaagccatgactacccttggaattgattatgtaaatcccagaagt
gcagaggaccaacgacaactttatgcaatggcaaataccctggaagatggtggcatgaca
cctcaactggctgaggtaataaaacggctgtggagagatccaggaattcaggcctgcttt
gaaagggcatctgaatatcagctcaatgactcagcagcttactaccttaatgatttagat
agaataacagcatctgggtatgtgccaaatgaacaagatgttctccattctcgagtgaaa
acgactggaatcattgaaactcaattctcctttaaagacttgcacttcaggatgtttgat
gtaggtggacagagatctgagagaaagaagtggattcactgctttgaaggagttacatgc
attatattttgtgctgcacttagtgcctatgacatggtcctcgtggaagacgaagaagtg
aatagaatgcatgaaagccttcacctgttcaacagtatctgtaatcacaagtatttttca
acaacctccattgtcctgttcctcaacaaaaaagatatctttcaagaaaaggtaaccaag
gtgcatcttagtatctgctttccagaatacactgggccaaatacatttgaagatgcagga
aactacatcaagaaccagtttctagacctgaatttaaaaaaagaagataaggaaatttat
tcccacatgacctgtgctactgacacccaaaatgtcaagtttgtgtttgacgcagttaca
gatataataatcaaagagaatctaaaagactgtgggcttttctaa

DBGET integrated database retrieval system