KEGG   Homo sapiens (human): 346562Help
Entry
346562            CDS       T01001                                 

Gene name
GNAT3, GDCA
Definition
guanine nucleotide binding protein, alpha transducing 3
Orthology
K04631  
guanine nucleotide-binding protein G(t) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Phototransduction
Carbohydrate digestion and absorption
Class
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Organismal Systems; Sensory system; Phototransduction [PATH:hsa04744]
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.11
AA seq 354 aa AA seqDB search
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMT
PQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggaattagttcagagagcaaggagtcagccaaaagatcaaaagaactggag
aaaaagcttcaggaggatgctgagcgagatgcaagaaccgtaaagctgctactattagga
gcaggagaatctgggaaaagtactattgttaaacaaatgaagatcatccataagaatggt
tacagtgagcaagaatgcatggagttcaaagcagtaatttacagtaatacattgcaatcc
atcctagctattgtgaaagccatgactacccttggaattgattatgtaaatcccagaagt
gcagaggaccaacgacaactttatgcaatggcaaataccctggaagatggtggcatgaca
cctcaactggctgaggtaataaaacggctgtggagagatccaggaattcaggcctgcttt
gaaagggcatctgaatatcagctcaatgactcagcagcttactaccttaatgatttagat
agaataacagcatctgggtatgtgccaaatgaacaagatgttctccattctcgagtgaaa
acgactggaatcattgaaactcaattctcctttaaagacttgcacttcaggatgtttgat
gtaggtggacagagatctgagagaaagaagtggattcactgctttgaaggagttacatgc
attatattttgtgctgcacttagtgcctatgacatggtcctcgtggaagacgaagaagtg
aatagaatgcatgaaagccttcacctgttcaacagtatctgtaatcacaagtatttttca
acaacctccattgtcctgttcctcaacaaaaaagatatctttcaagaaaaggtaaccaag
gtgcatcttagtatctgctttccagaatacactgggccaaatacatttgaagatgcagga
aactacatcaagaaccagtttctagacctgaatttaaaaaaagaagataaggaaatttat
tcccacatgacctgtgctactgacacccaaaatgtcaagtttgtgtttgacgcagttaca
gatataataatcaaagagaatctaaaagactgtgggcttttctaa

DBGET integrated database retrieval system