KEGG   Homo sapiens (human): 346606Help
Entry
346606            CDS       T01001                                 

Gene name
MOGAT3, DC7, DGAT2L7, MGAT3
Definition
monoacylglycerol O-acyltransferase 3 (EC:2.3.1.20 2.3.1.22)
Orthology
K14456  
2-acylglycerol O-acyltransferase 3 [EC:2.3.1.20 2.3.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    346606 (MOGAT3)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    346606 (MOGAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     346606 (MOGAT3)
    2.3.1.22  2-acylglycerol O-acyltransferase
     346606 (MOGAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 281 aa AA seqDB search
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL
VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC
TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ
PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGGPPHPRPPAPPPHRGGS
QSLSRPLHDGPGAALRGAQGKLWGPRFHLPHLHLGLAAAFR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgccacaaccctgcagcccccaaccacttccaaaaccttgcagaagcagcat
ctagaagcagtgggcgcctaccaatatgtgctcactttcctcttcatgggccctttcttc
tcccttcttgtctttgtcctcctcttcacgtcactctggcccttctctgttttttacttg
gtgtggctctatgtggactgggacacacccaaccaaggtggaaggcgttcggagtggata
aggaaccgggcaatttggagacaactaagggattattatcctgtcaagctggtgaaaaca
gcagagctgcccccggatcggaactacgtgctgggcgcccaccctcatgggatcatgtgt
acaggcttcctctgtaatttctccaccgagagcaatggcttctcccagctcttcccgggg
ctccggccctggttagccgtgctggctggcctcttctacctcccggtctatcgcgactac
atcatgtcctttggactctgtccggtgagccgccagagcctggacttcatcctgtcccag
ccccagctcgggcaggccgtggtcatcatggtggggggtgcgcacgaggccctgtattca
gtccccggggagcactgccttacgctccagaagcgcaaaggcttcgtgcgcctggcgctg
aggcacggtgggccgccccatccccgtcccccagcgcctccaccccaccgaggaggaagt
caatcactatcacgccctctacatgacggccctggagcagctcttcgaggagcacaagga
aagctgtggggtccccgcttccacctgcctcaccttcatctaggcctggccgcggccttt
cgctga

DBGET integrated database retrieval system