KEGG   Homo sapiens (human): 347344Help
Entry
347344            CDS       T01001                                 

Gene name
ZNF81, HFZ20, MRX45, dJ54B20.6
Definition
(RefSeq) zinc finger protein 81
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Disease
H00480  Non-syndromic X-linked mental retardation
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    347344 (ZNF81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz DZR zf-C2H2_11 zinc_ribbon_15 zf-trcl C1_4 ADK_lid Zn_ribbon_SprT DUF3268 zf-met Rpr2 zf-UBP Raffinose_syn DUF4279
Motif
Other DBs
NCBI-GeneID: 347344
NCBI-ProteinID: NP_009068
OMIM: 314998
HGNC: 13156
Ensembl: ENSG00000197779
Vega: OTTHUMG00000021462
Pharos: P51508(Tbio)
UniProt: P51508
Position
Xp11.23
AA seq 661 aa AA seqDB search
MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSV
GFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDT
RDDSLYSILEELWQDAEQIKRCQEKHNKLLSRTTFLNKKILNTEWDYEYKDFGKFVHPSP
NLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQVFTQNSSYSHHENTH
TGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANTCTEFGKIFTQRSHFFAPQKIHTVEK
PHELSKCVNVFTQKPLLSIYLRVHRDEKLYICTKCGKAFIQNSELIMHEKTHTREKPYKC
NECGKSFFQVSSLLRHQTTHTGEKLFECSECGKGFSLNSALNIHQKIHTGERHHKCSECG
KAFTQKSTLRMHQRIHTGERSYICTQCGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFP
SKSQLQMHKRIHTGEKPYICTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSN
FNKHQTIHTGEKPYVCADCGRAFIQKSELITHQRIHTTEKPYKCPDCEKSFSKKPHLKVH
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQKSVLSMHRNIH
T
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgccagctaacgaggacgctccccagccaggggaacatggcagtgcctgtgaggtatca
gtgtcatttgaggatgtgactgtggacttcagtagagaggagtggcagcaactggactct
actcaaagacgcctgtaccaggatgtaatgttggagaactacagccacctgctctcagtg
gggttcgaagttcctaaaccagaggtcatcttcaagttggagcaaggagaggggccatgg
acattggaaggggaagccccacatcagagctgttcagatgggaaatttggaattaagcct
tcccagaggagaatttctgggaaatctacatttcatagtgaaatggagggtgaagacaca
agagatgattcattatactctattttagaagaattgtggcaagatgctgaacagataaag
agatgtcaggaaaaacacaacaaacttctgagtcgcactactttcctcaataagaaaata
ttgaatacagagtgggattatgaatataaagactttggaaaatttgttcatccaagccca
aatctcattctttcacagaaaagaccccataaacgtgattcatttgggaagagttttaag
cataatttagacttacatattcataataaaagcaatgcagcaaagaacctggataaaact
attgggcatggtcaagtttttacccagaactcttcttatagtcaccacgaaaatacacat
acaggagtgaagttctgtgaacgtaatcaatgtggaaaagtcctcagcctcaaacactca
ctcagtcaaaatgtgaaatttcccattggagagaaagcaaacacatgtactgaatttggg
aagatcttcacccagaggtcacatttctttgctcctcaaaaaattcatactgtggaaaaa
cctcatgagcttagcaaatgtgtaaatgtttttacacagaagccactactcagtatatat
ctgagagttcatagagatgaaaaactctacatatgtactaaatgtgggaaggccttcatc
cagaattcagaattaattatgcatgagaaaactcatactagagagaaaccctataaatgc
aatgaatgtgggaaatcatttttccaggtgtcatctctactcaggcatcagacaactcat
actggagaaaaactctttgaatgcagtgaatgtggtaaaggcttctccctgaactcagcc
ctcaatatacatcagaaaattcacactggagagagacatcacaaatgcagtgagtgtggg
aaagcctttacccaaaaatcaacactcaggatgcatcagagaattcatacaggagagagg
tcctatatctgtactcaatgtgggcaggccttcatccagaaggcacacttgattgcacat
caaagaattcatactggagagaagccttatgaatgcagtgactgtgggaaatctttccct
tctaagtcacaactccagatgcataagagaattcatacaggagagaaaccctatatatgc
actgaatgtgggaaggctttcaccaacaggtcaaatctcaatactcaccagaagtctcat
actggagaaaagtcttatatatgtgctgaatgtgggaaggccttcaccgacaggtcaaat
ttcaataaacaccagaccattcacactggagagaaaccctatgtttgtgctgattgtggg
agggccttcatccagaagtcagagttgattacacatcagagaattcatactacagagaag
ccttataaatgtcctgactgtgagaaatccttctccaagaaaccacatctcaaagtacat
caacgaattcacacaggggagaaaccatatatatgtgcagaatgtgggaaagccttcact
gataggtcaaatttcaataaacatcagacaattcatactggagataaaccgtataaatgc
agcgactgtggaaaggggttcacccagaaatcagttctcagtatgcatcgcaatattcat
acatga

DBGET integrated database retrieval system