KEGG   Homo sapiens (human): 347468Help
Entry
347468            CDS       T01001                                 

Gene name
OR13H1, ORX1
Definition
(RefSeq) olfactory receptor family 13 subfamily H member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    347468 (OR13H1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    347468 (OR13H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 347468
NCBI-ProteinID: NP_001004486
HGNC: 14755
Ensembl: ENSG00000171054
Vega: OTTHUMG00000022411
Pharos: Q8NG92(Tdark)
UniProt: Q8NG92 A0A126GW70
Position
Xq26.2
AA seq 308 aa AA seqDB search
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY
DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEI
LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTC
GSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAI
RKVMLKRT
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggccatggacaatgtcacagcagtgtttcagtttctccttattggcatttctaactat
cctcaatggagagacacgtttttcacattagtgctgataatttacctcagcacattgttg
gggaatggatttatgatctttcttattcactttgaccccaacctccacactccaatctac
ttcttccttagtaacctgtctttcttagacctttgttatggaacagcttccatgccccag
gctttggtgcattgtttctctacccatccctacctctcttatccccgatgtttggctcaa
acgagtgtctccttggctttggccacagcagagtgcctcctactggctgccatggcctat
gaccgtgtggttgctatcagcaatcccctgcgttattcagtggttatgaatggcccagta
tgtgtctgcttggttgctacctcatgggggacatcacttgtgctcactgccatgctcatc
ctatccctgaggcttcacttctgtggggctaatgtcatcaaccattttgcctgtgagatt
ctctccctcattaagctgacctgttctgataccagcctcaatgaatttatgatcctcatc
accagtatcttcaccctgctgctaccatttgggtttgttctcctctcctacatacgaatt
gctatggctatcataaggattcgctcactccagggcaggctcaaggcctttaccacatgt
ggctctcacctgaccgtggtgacaatcttctatgggtcagccatctccatgtatatgaaa
actcagtccaagtcctaccctgaccaggacaagtttatctcagtgttttatggagctttg
acacccatgttgaaccccctgatatatagcctgagaaaaaaagatgttaaacgggcaata
aggaaagttatgttgaaaaggacatga

DBGET integrated database retrieval system