KEGG   Homo sapiens (human): 3476Help
Entry
3476              CDS       T01001                                 

Gene name
IGBP1, ALPHA-4, IBP1
Definition
(RefSeq) immunoglobulin (CD79A) binding protein 1
  KO
K17606  
immunoglobulin-binding protein 1
Organism
hsa  Homo sapiens (human)
Disease
H01035  
Corpus callosum, agenesis of, with mental retardation, ocular coloboma and micrognathia
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     3476 (IGBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq13.1-q13.3
AA seq 339 aa AA seqDB search
MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLD
LFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYH
VAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVE
SGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPV
KPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ
EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaggacgagttacagctgccgcggctccccgagctgttcgaaactggtaga
cagttactggacgaagtagaagtggcgactgaacccgccggttcccggatagtccaggag
aaggtgttcaagggcttggacctccttgagaaggctgccgaaatgttatcgcagctcgac
ttgttcagccgaaatgaagatttggaagagattgcttccaccgacctgaagtaccttttg
gtgccagcgtttcaaggagccctcaccatgaaacaagtcaaccccagcaagcgtctagat
catttgcagcgggctcgagaacactttataaactacttaactcagtgccattgctatcat
gtggcagagtttgagctgcccaaaaccatgaacaactctgctgaaaatcacactgccaat
tcctccatggcttatcctagtctcgttgctatggcatctcaaagacaggctaaaatacag
agatacaagcagaagaaggagttggagcataggttgtctgcaatgaaatctgctgtggaa
agtggtcaagcagatgatgagcgtgttcgtgaatattatcttcttcaccttcagaggtgg
attgatatcagcttagaagagattgagagcattgaccaggaaataaagatcctgagagaa
agagactcttcaagagaggcatcaacttctaactcatctcgccaggagaggcctccagtg
aaacccttcattctcactcggaacatggctcaagccaaagtatttggagctggttatcca
agtctgccaactatgacggtgagtgactggtatgagcaacatcggaaatatggagcatta
ccggatcagggaatagccaaggcagcaccagaggaattcagaaaagcagctcagcaacag
gaagaacaagaagaaaaggaggaagaggatgatgaacaaacactccacagagcccgggag
tgggatgactggaaggacacccatcctaggggctatgggaaccgacagaacatgggctga

DBGET integrated database retrieval system