KEGG   Homo sapiens (human): 348094Help
Entry
348094            CDS       T01001                                 

Gene name
ANKDD1A
Definition
(RefSeq) ankyrin repeat and death domain containing 1A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22.31
AA seq 522 aa AA seqDB search
MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGH
EQAVRLLLEHEAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCE
SKDGLTLLHCAAQKGHVPVLAFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVG
SGCDHNVKDKEGNTALHLAAGRGHMAVLQRLVDIGLDLEEQNAEGLTALHSAAGGSHPDC
VQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVR
HNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDLNLRDKQGKTA
LAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKA
LFEGLVAIGRRDLAGWSTMARSQLTATSASRVQMILVPQPPE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggagctggcgtgggagaccgacggcctgcttcctctggagaggcagctccac
gaggccgcccgccagaacaatgtcggcaggatgcaggagctgattgggaggagggttaac
accagggccagaaaccacgtgggcagggtggccctgcactgggctgcaggtgcagggcac
gagcaggctgtgcgtctgcttctggagcacgaggctgctgtggacgaggaggatgcggta
ggggccctcacagaggcacgtctgtgttttgggatgaatgcgcttctcctgtctgcctgg
ttcggccacttacgaatcctccagatcttggtaaactcaggggccaagatccactgtgag
agcaaggatggcctgaccttactgcactgcgcagcccaaaaaggccatgtgcctgtgctg
gcgttcataatggaggacctggaggatgtggccctggaccacgtagacaagctggggagg
acggcgtttcacagggcagctgagcacgggcagctggatgctctggacttcctcgtgggc
tctggctgtgaccacaatgtcaaagacaaggaggggaacactgcccttcatctggctgct
ggtcggggccatatggctgtgctgcagcgacttgtggacatcgggctggacctggaggag
cagaatgcggaaggtctgactgccctgcattcggctgctggaggatcccaccctgactgt
gtgcagctcctcctcagggctgggagcaccgtgaatgccctcacccagaaaaacctaagc
tgccttcactatgcagccctcagtggctcggaggatgtgtctcgggtcctcatccacgca
ggaggctgcgccaacgtggttgatcatcagggtgcctctcctctgcacctcgctgtgagg
cacaacttccctgccttggtccggctcctcatcaactccgacagtgacgtgaatgccgtg
gacaataggcagcagacgccccttcacctggctgcagagcacgcctggcaggacatagca
gatatgctcctcattgctggggttgacttaaacctgagagataagcagggaaaaaccgcc
ctggcagtggccgtccgcagcaaccatgtcagcctggtggacatgatcataaaagctgat
cgtttctacagatgggagaaggaccaccccagtgatccctctgggaagagcttgtccttt
aagcaggaccatcggcaggaaacacagcagctccgttctgtgctgtggcggctggcctcc
aggtatctgcagccccgtgagtggaagaagctggcatattcctgggagttcacggaggca
catgtcgacgccatcgagcaacagtggacaggcaccaggagctatcaggagcacggccac
cgaatgctgctcatttggctgcatggcgtggccacggctggtgagaaccccagcaaagcg
ctgttcgagggcctcgtggccattggcaggagggacctggctggctggagtacaatggcg
agatctcagctcacggcaacctccgcctcccgggttcaaatgattcttgtgcctcagcct
cccgagtag

DBGET integrated database retrieval system