KEGG   Homo sapiens (human): 348158Help
Entry
348158            CDS       T01001                                 

Gene name
ACSM2B, ACSM2, HXMA, HYST1046
Definition
(RefSeq) acyl-CoA synthetase medium chain family member 2B
  KO
K01896  medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    348158 (ACSM2B)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  butyrate---CoA ligase
     348158 (ACSM2B)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   348158 (ACSM2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 348158
NCBI-ProteinID: NP_001098539
OMIM: 614359
HGNC: 30931
Ensembl: ENSG00000066813
Vega: OTTHUMG00000131555
Pharos: Q68CK6(Tdark)
UniProt: Q68CK6
Position
16p12.3
AA seq 577 aa AA seqDB search
MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKA
GKRLPSPALWWVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWW
LVILGCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIK
LLVSEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGL
KAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLGACTFVHLLPKFDPLVILKTL
SSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWRAQTGLDIREF
YGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI
GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVEN
ALMKHPAVVETAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKY
PRKIEFVLNLPKTVTGKIQRTKLRDKEWKMSGKARAQ
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcattggctgcgaaaagttcagggactttgcaccctgtggggtactcagatgtccagc
cgcactctctacattaatagtaggcaactggtgtccctgcagtggggccaccaggaagtg
ccggccaagtttaactttgctagtgatgtgttggatcactgggctgacatggagaaggct
ggcaagcgactcccaagcccagccctgtggtgggtgaatgggaaggggaaggaattaatg
tggaatttcagagaactgagtgaaaacagccagcaggcagccaacatcctctcgggagcc
tgtggcctgcagcgtggggatcgtgtggcagtgatgctgccccgagtgcctgagtggtgg
ctggtgatcctgggctgcattcgagcaggtctcatctttatgcctggaaccatccagatg
aaatccactgacatactgtataggttgcagatgtctaaggccaaggctattgttgctggg
gatgaagtcatccaagaagtggacacagtggcatctgaatgtccttctctgagaattaag
ctactggtgtctgagaaaagctgcgatgggtggctgaacttcaagaaactactaaatgag
gcatccaccactcatcactgtgtggagactggaagccaggaagcatctgccatctacttc
actagtgggaccagtggtcttcccaagatggcagaacattcctactcgagcctgggcctc
aaggccaagatggatgctggttggacaggcctgcaagcctctgatataatgtggaccata
tcagacacaggttggatactgaacatcttgggctcacttttggaatcttggacattagga
gcatgcacatttgttcatctcttgccaaagtttgacccactggttattctaaagacactc
tccagttatccaatcaagagtatgatgggtgcccctattgtttaccggatgttgctacag
caggatctttccagttacaagttcccccatctacagaactgcctcgctggaggggagtcc
cttcttccagaaactctggagaactggagggcccagacaggactggacatccgagaattc
tatggccagacagaaacgggattaacttgcatggtttccaagacaatgaaaatcaaacca
ggatacatgggaacggctgcttcctgttatgatgtacaggttatagatgataagggcaac
gtcctgccccccggcacagaaggagacattggcatcagggtcaaacccatcaggcctata
ggcatcttctctggctatgtggaaaatcccgacaagacagcagccaacattcgaggagac
ttttggctccttggagaccggggaatcaaagatgaagatgggtatttccagtttatggga
cgggcagatgatatcattaactccagcgggtaccggattggaccctcggaggtagagaat
gcactgatgaagcaccctgctgtggttgagacggctgtgatcagcagcccagaccccgtc
cgaggagaggtggtgaaggcatttgtgatcctggcctcgcagttcctatcccatgaccca
gaacagctcaccaaggagctgcagcagcatgtgaagtcagtgacagccccatacaagtac
ccaagaaagatagagtttgtcttgaacctgcccaagactgtcacagggaaaattcaacga
accaaacttcgagacaaggagtggaagatgtccggaaaagcccgtgcgcagtga

DBGET integrated database retrieval system