KEGG   Homo sapiens (human): 348180Help
Entry
348180            CDS       T01001                                 

Gene name
CTU2, C16orf84, NCS2, UPF0432
Definition
cytosolic thiouridylase subunit 2 homolog (S. pombe)
Orthology
K14169  
cytoplasmic tRNA 2-thiolation protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur relay system
Class
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:hsa04122]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 515 aa AA seqDB search
MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFR
AMLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACG
QSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDS
FLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEALSQLFCSVRTLTAKEE
LLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGD
VVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPST
VSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSP
IPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLP
PYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaggtgggcgaggactacggggagccggcgcctgaggagccgcccccggcgccg
cggcccagccgtgagcagaagtgtgtgaagtgcaaggaagcgcagcccgttgtggtgata
cgagccggagatgccttctgcagggactgtttcaaggccttctacgtccacaagttcaga
gccatgctgggcaagaaccggctcatctttccaggcgagaaggtgctcttggcgtggtct
ggggggccttcgtccagctccatggtctggcaggttcttgagggcctgagccaagattct
gccaaaagactgcgctttgtggcaggagtcatctttgttgacgagggagcagcctgtggc
cagagcctagaggagagatcaaagaccctggccgaagtgaagcccattctgcaagcaact
gggttcccatggcatgtggtggccttagaggaggtgttcagcctgccaccgtcggtgctt
tggtgctctgcccaggagctggtgggatccgagggggcctacaaggcggccgtggacagc
ttcctccagcagcagcatgtgctgggggccgggggtggtcctggcccgactcaaggggag
gaacagccaccccagcccccgctggacccccagaacctggcaagaccgcctgcccctgcc
cagactgaggctctttcccaactgttctgctcagtgaggacactgactgccaaggaggag
cttctgcagaccctgcggacccacctgatcctccacatggcccgagcccacggctactcc
aaggtcatgactggggacagctgcacacgcttggctatcaagctcatgaccaacctggcg
ctgggtcgaggggccttcctggcctgggatacgggcttctcggatgagcggcacggggac
gtggtggtggtgcggcccatgcgggaccacaccctgaaggaggtcgctttctacaaccgc
ctgttctccgttccttctgtcttcacaccagccgtcgacaccaaggcccctgaaaaggcc
agcatccaccggctgatggaggccttcatcctcaggctgcagacccagttcccctccact
gtcagcactgtgtacaggacaagtgagaagctggtgaagggcccccgggatggccctgct
gctggcgactccggcccccgctgcctcctctgcatgtgtgccctggacgtcgacgccgct
gacagtgccacggcttttggggctcagacctcctcgcgtctctcccagatgcagtcaccc
atccccctgactgagacccggacacccccggggccctgctgttctccaggggtgggctgg
gcccagcgctgtggccagggggcctgcaggagggaggacccccaagcctgcattgaggag
cagctgtgctacagctgccgcgtgaacatgaaggacttgccctcactggaccccctgccg
ccgtacatcctggctgaggcccagctccgcacacagagggcctggggcttgcaggagatc
cgggactgtctgattgaggacagtgacgacgaggcgggccagagctga

DBGET integrated database retrieval system