KEGG   Homo sapiens (human): 3482Help
Entry
3482              CDS       T01001                                 

Gene name
IGF2R, CD222, CIMPR, M6P-R, MPR1, MPRI
Definition
insulin-like growth factor 2 receptor
Orthology
K06564  
insulin-like growth factor 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00048  
Hepatocellular carcinoma
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q26
AA seq 2491 aa AA seqDB search
MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDIVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGH
QAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYL
FYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSG
IGKIFMFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIVRFVCNDDVYSGPLKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCQGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFR
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCH
KVYQRSTAIFFYCDRGTQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFD
LSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRV
RDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAW
PTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCP
PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGP
TNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESE
DDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEI
YLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVR
MDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSG
TKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPFIFNGKSYEECIIE
SRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFE
WKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYYINLCQKIYKGPLGCS
ERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV
GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRA
SGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDG
DLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPL
GVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALLLYKKERRETVISKLT
TCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALS
SLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDRVGLVRGEKAR
KGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI
NT seq 7476 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgccgccggccggagcccccacctggggcccgcgcccgcccgccgcccgcag
cgctctctgctcctgctgcagctgctgctgctcgtcgctgccccggggtccacgcaggcc
caggccgccccgttccccgagctgtgcagttatacatgggaagctgttgataccaaaaat
aatgtactttataaaatcaacatctgtggaagtgtggatattgtccagtgcgggccatca
agtgctgtttgtatgcacgacttgaagacacgcacttatcattcagtgggtgactctgtt
ttgagaagtgcaaccagatctctcctggaattcaacacaacagtgagctgtgaccagcaa
ggcacaaatcacagagtccagagcagcattgccttcctgtgtgggaaaaccctgggaact
cctgaatttgtaactgcaacagaatgtgtgcactactttgagtggaggaccactgcagcc
tgcaagaaagacatatttaaagcaaataaggaggtgccatgctatgtgtttgatgaagag
ttgaggaagcatgatctcaatcctctgatcaagcttagtggtgcctacttggtggatgac
tccgatccggacacttctctattcatcaatgtttgtagagacatagacacactacgagac
ccaggttcacagctgcgggcctgtccccccggcactgccgcctgcctggtaagaggacac
caggcgtttgatgttggccagccccgggacggactgaagctggtgcgcaaggacaggctt
gtcctgagttacgtgagggaagaggcaggaaagctagacttttgtgatggtcacagccct
gcggtgactattacatttgtttgcccgtcggagcggagagagggcaccattcccaaactc
acagctaaatccaactgccgctatgaaattgagtggattactgagtatgcctgccacaga
gattacctggaaagtaaaacttgttctctgagcggcgagcagcaggatgtctccatagac
ctcacaccacttgcccagagcggaggttcatcctatatttcagatggaaaagaatatttg
ttttatttgaatgtctgtggagaaactgaaatacagttctgtaataaaaaacaagctgca
gtttgccaagtgaaaaagagcgatacctctcaagtcaaagcagcaggaagataccacaat
cagaccctccgatattcggatggagacctcaccttgatatattttggaggtgatgaatgc
agctcagggtttcagcggatgagcgtcataaactttgagtgcaataaaaccgcaggtaac
gatgggaaaggaactcctgtattcacaggggaggttgactgcacctacttcttcacatgg
gacacggaatacgcctgtgttaaggagaaggaagacctcctctgcggtgccaccgacggg
aagaagcgctatgacctgtccgcgctggtccgccatgcagaaccagagcagaattgggaa
gctgtggatggcagtcagacggaaacagagaagaagcattttttcattaatatttgtcac
agagtgctgcaggaaggcaaggcacgagggtgtcccgaggacgcggcagtgtgtgcagtg
gataaaaatggaagtaaaaatctgggaaaatttatttcctctcccatgaaagagaaagga
aacattcaactctcttattcagatggtgatgattgtggtcatggcaagaaaattaaaact
aatatcacacttgtatgcaagccaggtgatctggaaagtgcaccagtgttgagaacttct
ggggaaggcggttgcttttatgagtttgagtggcacacagctgcggcctgtgtgctgtct
aagacagaaggggagaactgcacggtctttgactcccaggcagggttttcttttgactta
tcacctctcacaaagaaaaatggtgcctataaagttgagacaaagaagtatgacttttat
ataaatgtgtgtggcccggtgtctgtgagcccctgtcagccagactcaggagcctgccag
gtggcaaaaagtgatgagaagacttggaacttgggtctgagtaatgcgaagctttcatat
tatgatgggatgatccaactgaactacagaggcggcacaccctataacaatgaaagacac
acaccgagagctacgctcatcacctttctctgtgatcgagacgcgggagtgggcttccct
gaatatcaggaagaggataactccacctacaacttccggtggtacaccagctatgcctgc
ccggaggagcccctggaatgcgtagtgaccgacccctccacgctggagcagtacgacctc
tccagtctggcaaaatctgaaggtggccttggaggaaactggtatgccatggacaactca
ggggaacatgtcacgtggaggaaatactacattaacgtgtgtcggcctctgaatccagtg
ccgggctgcaaccgatatgcatcggcttgccagatgaagtatgaaaaagatcagggctcc
ttcactgaagtggtttccatcagtaacttgggaatggcaaagaccggcccggtggttgag
gacagcggcagcctccttctggaatacgtgaatgggtcggcctgcaccaccagcgatggc
agacagaccacatataccacgaggatccatctcgtctgctccaggggcaggctgaacagc
caccccatcttttctctcaactgggagtgtgtggtcagtttcctgtggaacacagaggct
gcctgtcccattcagacaacgacggatacagaccaggcttgctctataagggatcccaac
agtggatttgtgtttaatcttaatccgctaaacagttcgcaaggatataacgtctctggc
attgggaagatttttatgtttaatgtctgcggcacaatgcctgtctgtgggaccatcctg
ggaaaacctgcttctggctgtgaggcagaaacccaaactgaagagctcaagaattggaag
ccagcaaggccagtcggaattgagaaaagcctccagctgtccacagagggcttcatcact
ctgacctacaaagggcctctctctgccaaaggtaccgctgatgcttttatcgtccgcttt
gtttgcaatgatgatgtttactcagggcccctcaaattcctgcatcaagatatcgactct
gggcaagggatccgaaacacttactttgagtttgaaaccgcgttggcctgtgttccttct
ccagtggactgccaagtcaccgacctggctggaaatgagtacgacctgactggcctaagc
acagtcaggaaaccttggacggctgttgacacctctgtcgatgggagaaagaggactttc
tatttgagcgtttgcaatcctctcccttacattcctggatgccagggcagcgcagtgggg
tcttgcttagtgtcagaaggcaatagctggaatctgggtgtggtgcagatgagtccccaa
gccgcggcgaatggatctttgagcatcatgtatgtcaacggtgacaagtgtgggaaccag
cgcttctccaccaggatcacgtttgagtgtgctcagatatcgggctcaccagcatttcag
cttcaggatggttgtgagtacgtgtttatctggagaactgtggaagcctgtcccgttgtc
agagtggaaggggacaactgtgaggtgaaagacccaaggcatggcaacttgtatgacctg
aagcccctgggcctcaacgacaccatcgtgagcgctggcgaatacacttattacttccgg
gtctgtgggaagctttcctcagacgtctgccccacaagtgacaagtccaaggtggtctcc
tcatgtcaggaaaagcgggaaccgcagggatttcacaaagtggcaggtctcctgactcag
aagctaacttatgaaaatggcttgttaaaaatgaacttcacggggggggacacttgccat
aaggtttatcagcgctccacagccatcttcttctactgtgaccgcggcacccagcggcca
gtatttctaaaggagacttcagattgttcctacttgtttgagtggcgaacgcagtatgcc
tgcccacctttcgatctgactgaatgttcattcaaagatggggctggcaactccttcgac
ctctcgtccctgtcaaggtacagtgacaactgggaagccatcactgggacgggggacccg
gagcactacctcatcaatgtctgcaagtctctggccccgcaggctggcactgagccgtgc
cctccagaagcagccgcgtgtctgctgggtggctccaagcccgtgaacctcggcagggta
agggacggacctcagtggagagatggcataattgtcctgaaatacgttgatggcgactta
tgtccagatgggattcggaaaaagtcaaccaccatccgattcacctgcagcgagagccaa
gtgaactccaggcccatgttcatcagcgccgtggaggactgtgagtacacctttgcctgg
cccacagccacagcctgtcccatgaagagcaacgagcatgatgactgccaggtcaccaac
ccaagcacaggacacctgtttgatctgagctccttaagtggcagggcgggattcacagct
gcttacagcgagaaggggttggtttacatgagcatctgtggggagaatgaaaactgccct
cctggcgtgggggcctgctttggacagaccaggattagcgtgggcaaggccaacaagagg
ctgagatacgtggaccaggtcctgcagctggtgtacaaggatgggtccccttgtccctcc
aaatccggcctgagctataagagtgtgatcagtttcgtgtgcaggcctgaggccgggcca
accaataggcccatgctcatctccctggacaagcagacatgcactctcttcttctcctgg
cacacgccgctggcctgcgagcaagcgaccgaatgttccgtgaggaatggaagctctatt
gttgacttgtctccccttattcatcgcactggtggttatgaggcttatgatgagagtgag
gatgatgcctccgataccaaccctgatttctacatcaatatttgtcagccactaaatccc
atgcacggagtgccctgtcctgccggagccgctgtgtgcaaagttcctattgatggtccc
cccatagatatcggccgggtagcaggaccaccaatactcaatccaatagcaaatgagatt
tacttgaattttgaaagcagtactccttgcttagcggacaagcatttcaactacacctcg
ctcatcgcgtttcactgtaagagaggtgtgagcatgggaacgcctaagctgttaaggacc
agcgagtgcgactttgtgttcgaatgggagactcctgtcgtctgtcctgatgaagtgagg
atggatggctgtaccctgacagatgagcagctcctctacagcttcaacttgtccagcctt
tccacgagcacctttaaggtgactcgcgactcgcgcacctacagcgttggggtgtgcacc
tttgcagtcgggccagaacaaggaggctgtaaggacggaggagtctgtctgctctcaggc
accaagggggcatcctttggacggctgcaatcaatgaaactggattacaggcaccaggat
gaagcggtcgttttaagttacgtgaatggtgatcgttgccctccagaaaccgatgacggc
gtcccctgtgtcttccccttcatattcaatgggaagagctacgaggagtgcatcatagag
agcagggcgaagctgtggtgtagcacaactgcggactacgacagagaccacgagtggggc
ttctgcagacactcaaacagctaccggacatccagcatcatatttaagtgtgatgaagat
gaggacattgggaggccacaagtcttcagtgaagtgcgtgggtgtgatgtgacatttgag
tggaaaacaaaagttgtctgccctccaaagaagttggagtgcaaattcgtccagaaacac
aaaacctacgacctgcggctgctctcctctctcaccgggtcctggtccctggtccacaac
ggagtctcgtactatataaatctgtgccagaaaatatataaagggcccctgggctgctct
gaaagggccagcatttgcagaaggaccacaactggtgacgtccaggtcctgggactcgtt
cacacgcagaagctgggtgtcataggtgacaaagttgttgtcacgtactccaaaggttat
ccgtgtggtggaaataagaccgcatcctccgtgatagaattgacctgtacaaagacggtg
ggcagacctgcattcaagaggtttgatatcgacagctgcacttactacttcagctgggac
tcccgggctgcctgcgccgtgaagcctcaggaggtgcagatggtgaatgggaccatcacc
aaccctataaatggcaagagcttcagcctcggagatatttattttaagctgttcagagcc
tctggggacatgaggaccaatggggacaactacctgtatgagatccaactttcctccatc
acaagctccagaaacccggcgtgctctggagccaacatatgccaggtgaagcccaacgat
cagcacttcagtcggaaagttggaacctctgacaagaccaagtactaccttcaagacggc
gatctcgatgtcgtgtttgcctcttcctctaagtgcggaaaggataagaccaagtctgtt
tcttccaccatcttcttccactgtgaccctctggtggaggacgggatccccgagttcagt
cacgagactgccgactgccagtacctcttctcttggtacacctcagccgtgtgtcctctg
ggggtgggctttgacagcgagaatcccggggacgacgggcagatgcacaaggggctgtca
gaacggagccaggcagtcggcgcggtgctcagcctgctgctggtggcgctcacctgctgc
ctgctggccctgttgctctacaagaaggagaggagggaaacagtgataagtaagctgacc
acttgctgtaggagaagttccaacgtgtcctacaaatactcaaaggtgaataaggaagaa
gagacagatgagaatgaaacagagtggctgatggaagagatccagctgcctcctccacgg
cagggaaaggaagggcaggagaacggccatattaccaccaagtcagtgaaagccctcagc
tccctgcatggggatgaccaggacagtgaggatgaggttctgaccatcccagaggtgaaa
gttcactcgggcaggggagctggggcagagagctcccacccagtgagaaacgcacagagc
aatgcccttcaggagcgtgaggacgatagggtggggctggtcaggggtgagaaggcgagg
aaagggaagtccagctctgcacagcagaagacagtgagctccaccaagctggtgtccttc
catgacgacagcgacgaggacctcttacacatctga

DBGET integrated database retrieval system