KEGG   Homo sapiens (human): 3484Help
Entry
3484              CDS       T01001                                 

Gene name
IGFBP1, AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1
Definition
insulin-like growth factor binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p13-p12
AA seq 259 aa AA seqDB search
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQIYFNVQN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggtccccgttgctcgcgtctggctggtactgctcctgctgactgtccaggtc
ggcgtgacagccggcgctccgtggcagtgcgcgccctgctccgccgagaagctcgcgctc
tgcccgccggtgtccgcctcgtgctcggaggtcacccggtccgccggctgcggctgttgc
ccgatgtgcgccctgcctctgggcgccgcgtgcggcgtggcgactgcacgctgcgcccgg
ggactcagttgccgcgcgctgccgggggagcagcaacctctgcacgccctcacccgcggc
caaggcgcctgcgtgcaggagtctgacgcctccgctccccatgctgcagaggcagggagc
cctgaaagcccagagagcacggagataactgaggaggagctcctggataatttccatctg
atggccccttctgaagaggatcattccatcctttgggacgccatcagtacctatgatggc
tcgaaggctctccatgtcaccaacatcaaaaaatggaaggagccctgccgaatagaactc
tacagagtcgtagagagtttagccaaggcacaggagacatcaggagaagaaatttccaaa
ttttacctgccaaactgcaacaagaatggattttatcacagcagacagtgtgagacatcc
atggatggagaggcgggactctgctggtgcgtctacccttggaatgggaagaggatccct
gggtctccagagatcaggggagaccccaactgccagatatattttaatgtacaaaactga

DBGET integrated database retrieval system