KEGG   Homo sapiens (human): 3485Help
Entry
3485              CDS       T01001                                 

Gene name
IGFBP2, IBP2, IGF-BP53
Definition
(RefSeq) insulin like growth factor binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP Cys_rich_CWC
Motif
Other DBs
NCBI-GeneID: 3485
NCBI-ProteinID: NP_000588
OMIM: 146731
HGNC: 5471
Ensembl: ENSG00000115457
Vega: OTTHUMG00000155341
Pharos: P18065(Tchem)
UniProt: P18065
Structure
PDB: 

Jmol
Position
2q35
AA seq 328 aa AA seqDB search
MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPP
VAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGS
ELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAG
RKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLER
ISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGA
PTIRGDPECHLFYNEQQEARGVHTQRMQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgagagtgggctgccccgcgctgccgctgccgccgccgccgctgctgccgctg
ctgccgctgctgctgctgctactgggcgcgagtggcggcggcggcggggcgcgcgcggag
gtgctgttccgctgcccgccctgcacacccgagcgcctggccgcctgcgggcccccgccg
gttgcgccgcccgccgcggtggccgcagtggccggaggcgcccgcatgccatgcgcggag
ctcgtccgggagccgggctgcggctgctgctcggtgtgcgcccggctggagggcgaggcg
tgcggcgtctacaccccgcgctgcggccaggggctgcgctgctatccccacccgggctcc
gagctgcccctgcaggcgctggtcatgggcgagggcacttgtgagaagcgccgggacgcc
gagtatggcgccagcccggagcaggttgcagacaatggcgatgaccactcagaaggaggc
ctggtggagaaccacgtggacagcaccatgaacatgttgggcgggggaggcagtgctggc
cggaagcccctcaagtcgggtatgaaggagctggccgtgttccgggagaaggtcactgag
cagcaccggcagatgggcaagggtggcaagcatcaccttggcctggaggagcccaagaag
ctgcgaccaccccctgccaggactccctgccaacaggaactggaccaggtcctggagcgg
atctccaccatgcgccttccggatgagcggggccctctggagcacctctactccctgcac
atccccaactgtgacaagcatggcctgtacaacctcaaacagtgcaagatgtctctgaac
gggcagcgtggggagtgctggtgtgtgaaccccaacaccgggaagctgatccagggagcc
cccaccatccggggggaccccgagtgtcatctcttctacaatgagcagcaggaggctcgc
ggggtgcacacccagcggatgcagtag

DBGET integrated database retrieval system