KEGG   Homo sapiens (human): 3485Help
Entry
3485              CDS       T01001                                 

Gene name
IGFBP2, IBP2, IGF-BP53
Definition
insulin-like growth factor binding protein 2, 36kDa
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33-q34
AA seq 328 aa AA seqDB search
MLPRVGCPALPLPPPPLLPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPP
VAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGS
ELPLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAG
RKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLER
ISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGA
PTIRGDPECHLFYNEQQEARGVHTQRMQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgagagtgggctgccccgcgctgccgctgccgccgccgccgctgctgccgctg
ctgccgctgctgctgctgctactgggcgcgagtggcggcggcggcggggcgcgcgcggag
gtgctgttccgctgcccgccctgcacacccgagcgcctggccgcctgcgggcccccgccg
gttgcgccgcccgccgcggtggccgcagtggccggaggcgcccgcatgccatgcgcggag
ctcgtccgggagccgggctgcggctgctgctcggtgtgcgcccggctggagggcgaggcg
tgcggcgtctacaccccgcgctgcggccaggggctgcgctgctatccccacccgggctcc
gagctgcccctgcaggcgctggtcatgggcgagggcacttgtgagaagcgccgggacgcc
gagtatggcgccagcccggagcaggttgcagacaatggcgatgaccactcagaaggaggc
ctggtggagaaccacgtggacagcaccatgaacatgttgggcgggggaggcagtgctggc
cggaagcccctcaagtcgggtatgaaggagctggccgtgttccgggagaaggtcactgag
cagcaccggcagatgggcaagggtggcaagcatcaccttggcctggaggagcccaagaag
ctgcgaccaccccctgccaggactccctgccaacaggaactggaccaggtcctggagcgg
atctccaccatgcgccttccggatgagcggggccctctggagcacctctactccctgcac
atccccaactgtgacaagcatggcctgtacaacctcaaacagtgcaagatgtctctgaac
gggcagcgtggggagtgctggtgtgtgaaccccaacaccgggaagctgatccagggagcc
cccaccatccggggggaccccgagtgtcatctcttctacaatgagcagcaggaggctcgc
ggggtgcacacccagcggatgcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system