KEGG   Homo sapiens (human): 3486Help
Entry
3486              CDS       T01001                                 

Gene name
IGFBP3, BP-53, IBP3
Definition
insulin-like growth factor binding protein 3
Orthology
K10138  
insulin-like growth factor-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    3486 (IGFBP3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3486 (IGFBP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3486 (IGFBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p13-p12
AA seq 291 aa AA seqDB search
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc
gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc
gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag
ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg
tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag
gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc
agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg
gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg
tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct
aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc
tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca
ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt
gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc
ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag
gaggacgtgcactgctacagcatgcagagcaagtag

DBGET integrated database retrieval system