KEGG   Homo sapiens (human): 3488Help
Entry
3488              CDS       T01001                                 

Gene name
IGFBP5, IBP5
Definition
(RefSeq) insulin like growth factor binding protein 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 272 aa AA seqDB search
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctcaccgcggtcctcctgctgctggccgcctatgcggggccggcccagagc
ctgggctccttcgtgcactgcgagccctgcgacgagaaagccctctccatgtgccccccc
agccccctgggctgcgagctggtcaaggagccgggctgcggctgctgcatgacctgcgcc
ctggccgaggggcagtcgtgcggcgtctacaccgagcgctgcgcccaggggctgcgctgc
ctcccccggcaggacgaggagaagccgctgcacgccctgctgcacggccgcggggtttgc
ctcaacgaaaagagctaccgcgagcaagtcaagatcgagagagactcccgtgagcacgag
gagcccaccacctctgagatggccgaggagacctactcccccaagatcttccggcccaaa
cacacccgcatctccgagctgaaggctgaagcagtgaagaaggaccgcagaaagaagctg
acccagtccaagtttgtcgggggagccgagaacactgcccacccccggatcatctctgca
cctgagatgagacaggagtctgagcagggcccctgccgcagacacatggaggcttccctg
caggagctcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaattgtgac
cgcaaaggattctacaagagaaagcagtgcaaaccttcccgtggccgcaagcgtggcatc
tgctggtgcgtggacaagtacgggatgaagctgccaggcatggagtacgttgacggggac
tttcagtgccacaccttcgacagcagcaacgttgagtga

DBGET integrated database retrieval system