KEGG   Homo sapiens (human): 3488Help
Entry
3488              CDS       T01001                                 

Gene name
IGFBP5, IBP5
Definition
(RefSeq) insulin like growth factor binding protein 5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3488
NCBI-ProteinID: NP_000590
OMIM: 146734
HGNC: 5474
Ensembl: ENSG00000115461
Vega: OTTHUMG00000133058
Pharos: P24593(Tchem)
UniProt: P24593 A0A024R433
Structure
PDB: 

Jmol
Position
2q35
AA seq 272 aa AA seqDB search
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctcaccgcggtcctcctgctgctggccgcctatgcggggccggcccagagc
ctgggctccttcgtgcactgcgagccctgcgacgagaaagccctctccatgtgccccccc
agccccctgggctgcgagctggtcaaggagccgggctgcggctgctgcatgacctgcgcc
ctggccgaggggcagtcgtgcggcgtctacaccgagcgctgcgcccaggggctgcgctgc
ctcccccggcaggacgaggagaagccgctgcacgccctgctgcacggccgcggggtttgc
ctcaacgaaaagagctaccgcgagcaagtcaagatcgagagagactcccgtgagcacgag
gagcccaccacctctgagatggccgaggagacctactcccccaagatcttccggcccaaa
cacacccgcatctccgagctgaaggctgaagcagtgaagaaggaccgcagaaagaagctg
acccagtccaagtttgtcgggggagccgagaacactgcccacccccggatcatctctgca
cctgagatgagacaggagtctgagcagggcccctgccgcagacacatggaggcttccctg
caggagctcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaattgtgac
cgcaaaggattctacaagagaaagcagtgcaaaccttcccgtggccgcaagcgtggcatc
tgctggtgcgtggacaagtacgggatgaagctgccaggcatggagtacgttgacggggac
tttcagtgccacaccttcgacagcagcaacgttgagtga

DBGET integrated database retrieval system