KEGG   Homo sapiens (human): 348980Help
Entry
348980            CDS       T01001                                 

Gene name
HCN1, BCNG-1, BCNG1, EIEE24, HAC-2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 1
  KO
K04954  hyperpolarization activated cyclic nucleotide-gated potassium channel 1
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Ivabradine (DG00246): D07165 D08095
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Brain cyclic nucleotide-gated channel (HCN)
   348980 (HCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2 DUF1759
Motif
Other DBs
NCBI-GeneID: 348980
NCBI-ProteinID: NP_066550
OMIM: 602780
HGNC: 4845
Ensembl: ENSG00000164588
Vega: OTTHUMG00000131155
Pharos: O60741(Tclin)
UniProt: O60741 Q86WJ6
Structure
PDB: 

Jmol
Position
5p12
AA seq 890 aa AA seqDB search
MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGGGGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAV
EKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNV
ASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVE
KGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFN
LIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIG
YGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGE
ICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSI
LLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTTLNSTSSTTTPTSRM
RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLAARTFHYA
SPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKSTQALHNTNLT
REVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggcggcaagcccaactcttcgtctaacagccgggacgatggcaacagcgtc
ttccccgccaaggcgtccgcgacgggcgcggggccggccgcggccgagaagcgcctgggc
accccgccggggggcggcggggccggcgcgaaggagcacggcaactccgtgtgcttcaag
gtggacggcggtggcggcggtggcggcggcggcggcggcggcgaggagccggcggggggc
ttcgaagacgccgaggggccccggcggcagtacggcttcatgcagaggcagttcacctcc
atgctgcagcccggggtcaacaaattctccctccgcatgtttgggagccagaaggcggtg
gaaaaggagcaggaaagggttaaaactgcaggcttctggattatccacccttacagtgat
ttcaggttttactgggatttaataatgcttataatgatggttggaaatctagtcatcata
ccagttggaatcacattctttacagagcaaacaacaacaccatggattattttcaatgtg
gcatcagatacagttttcctattggacctgatcatgaattttaggactgggactgtcaat
gaagacagttctgaaatcatcctggaccccaaagtgatcaagatgaattatttaaaaagc
tggtttgtggttgacttcatctcatccatcccagtggattatatctttcttattgtagaa
aaaggaatggattctgaagtttacaagacagccagggcacttcgcattgtgaggtttaca
aaaattctcagtctcttgcgtttattacgactttcaaggttaattagatacatacatcaa
tgggaagagatattccacatgacatatgatctcgccagtgcagtggtgagaatttttaat
ctcatcggcatgatgctgctcctgtgccactgggatggttgtcttcagttcttagtacca
ctactgcaggacttcccaccagattgctgggtgtctttaaatgaaatggttaatgattct
tggggaaagcagtattcatacgcactcttcaaagctatgagtcacatgctgtgcattggg
tatggagcccaagccccagtcagcatgtctgacctctggattaccatgctgagcatgatc
gtcggggccacctgctatgccatgtttgtcggccatgccaccgctttaatccagtctctg
gattcttcgaggcggcagtatcaagagaagtataagcaagtggaacaatacatgtcattc
cataagttaccagctgatatgcgtcagaagatacatgattactatgaacacagataccaa
ggcaaaatctttgatgaggaaaatattctcaatgaactcaatgatcctctgagagaggag
atagtcaacttcaactgtcggaaactggtggctacaatgcctttatttgctaatgcggat
cctaattttgtgactgccatgctgagcaagttgagatttgaggtgtttcaacctggagat
tatatcatacgagaaggagccgtgggtaaaaaaatgtatttcattcaacacggtgttgct
ggtgtcattacaaaatccagtaaagaaatgaagctgacagatggctcttactttggagag
atttgcctgctgaccaaaggacgtcgtactgccagtgttcgagctgatacatattgtcgt
ctttactcactttccgtggacaatttcaacgaggtcctggaggaatatccaatgatgagg
agagcctttgagacagttgccattgaccgactagatcgaataggaaagaaaaattcaatt
cttctgcaaaagttccagaaggatctgaacactggtgttttcaacaatcaggagaacgaa
atcctcaagcagattgtgaaacatgacagggagatggtgcaggcaatcgctcccatcaat
tatcctcaaatgacaaccctgaattccacatcgtctactacgaccccgacctcccgcatg
aggacacaatctccaccggtgtacacagcgaccagcctgtctcacagcaacctgcactcc
cccagtcccagcacacagaccccccagccatcagccatcctgtcaccctgctcctacacc
accgcggtctgcagccctcctgtacagagccctctggccgctcgaactttccactatgcc
tcccccaccgcctcccagctgtcactcatgcaacagcagccgcagcagcaggtacagcag
tcccagccgccgcagactcagccacagcagccgtccccgcagccacagacacctggcagc
tccacgccgaaaaatgaagtgcacaagagcacgcaggcgcttcacaacaccaacctgacc
cgggaagtcaggccactctccgcctcgcagccctcgctgccccatgaggtgtccactctg
atttccagacctcatcccactgtgggcgagtccctggcctccatccctcaacccgtgacg
gcggtccccggaacgggccttcaggcagggggcaggagcactgtcccgcagcgcgtcacc
ctcttccgacagatgtcgtcgggagccatccccccgaaccgaggagtccctccagcaccc
cctccaccagcagctgctcttccaagagaatcttcctcagtcttaaacacagacccagac
gcagaaaagccacgatttgcttcaaatttatga

DBGET integrated database retrieval system