KEGG   Homo sapiens (human): 348980Help
Entry
348980            CDS       T01001                                 

Gene name
HCN1, BCNG-1, BCNG1, EIEE24, HAC-2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 1
  KO
K04954  
hyperpolarization activated cyclic nucleotide-gated potassium channel 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Brain cyclic nucleotide-gated channel (HCN)
   348980 (HCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p12
AA seq 890 aa AA seqDB search
MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGGGGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAV
EKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNV
ASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVE
KGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFN
LIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIG
YGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGE
ICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSI
LLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTTLNSTSSTTTPTSRM
RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLAARTFHYA
SPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKSTQALHNTNLT
REVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggcggcaagcccaactcttcgtctaacagccgggacgatggcaacagcgtc
ttccccgccaaggcgtccgcgacgggcgcggggccggccgcggccgagaagcgcctgggc
accccgccggggggcggcggggccggcgcgaaggagcacggcaactccgtgtgcttcaag
gtggacggcggtggcggcggtggcggcggcggcggcggcggcgaggagccggcggggggc
ttcgaagacgccgaggggccccggcggcagtacggcttcatgcagaggcagttcacctcc
atgctgcagcccggggtcaacaaattctccctccgcatgtttgggagccagaaggcggtg
gaaaaggagcaggaaagggttaaaactgcaggcttctggattatccacccttacagtgat
ttcaggttttactgggatttaataatgcttataatgatggttggaaatctagtcatcata
ccagttggaatcacattctttacagagcaaacaacaacaccatggattattttcaatgtg
gcatcagatacagttttcctattggacctgatcatgaattttaggactgggactgtcaat
gaagacagttctgaaatcatcctggaccccaaagtgatcaagatgaattatttaaaaagc
tggtttgtggttgacttcatctcatccatcccagtggattatatctttcttattgtagaa
aaaggaatggattctgaagtttacaagacagccagggcacttcgcattgtgaggtttaca
aaaattctcagtctcttgcgtttattacgactttcaaggttaattagatacatacatcaa
tgggaagagatattccacatgacatatgatctcgccagtgcagtggtgagaatttttaat
ctcatcggcatgatgctgctcctgtgccactgggatggttgtcttcagttcttagtacca
ctactgcaggacttcccaccagattgctgggtgtctttaaatgaaatggttaatgattct
tggggaaagcagtattcatacgcactcttcaaagctatgagtcacatgctgtgcattggg
tatggagcccaagccccagtcagcatgtctgacctctggattaccatgctgagcatgatc
gtcggggccacctgctatgccatgtttgtcggccatgccaccgctttaatccagtctctg
gattcttcgaggcggcagtatcaagagaagtataagcaagtggaacaatacatgtcattc
cataagttaccagctgatatgcgtcagaagatacatgattactatgaacacagataccaa
ggcaaaatctttgatgaggaaaatattctcaatgaactcaatgatcctctgagagaggag
atagtcaacttcaactgtcggaaactggtggctacaatgcctttatttgctaatgcggat
cctaattttgtgactgccatgctgagcaagttgagatttgaggtgtttcaacctggagat
tatatcatacgagaaggagccgtgggtaaaaaaatgtatttcattcaacacggtgttgct
ggtgtcattacaaaatccagtaaagaaatgaagctgacagatggctcttactttggagag
atttgcctgctgaccaaaggacgtcgtactgccagtgttcgagctgatacatattgtcgt
ctttactcactttccgtggacaatttcaacgaggtcctggaggaatatccaatgatgagg
agagcctttgagacagttgccattgaccgactagatcgaataggaaagaaaaattcaatt
cttctgcaaaagttccagaaggatctgaacactggtgttttcaacaatcaggagaacgaa
atcctcaagcagattgtgaaacatgacagggagatggtgcaggcaatcgctcccatcaat
tatcctcaaatgacaaccctgaattccacatcgtctactacgaccccgacctcccgcatg
aggacacaatctccaccggtgtacacagcgaccagcctgtctcacagcaacctgcactcc
cccagtcccagcacacagaccccccagccatcagccatcctgtcaccctgctcctacacc
accgcggtctgcagccctcctgtacagagccctctggccgctcgaactttccactatgcc
tcccccaccgcctcccagctgtcactcatgcaacagcagccgcagcagcaggtacagcag
tcccagccgccgcagactcagccacagcagccgtccccgcagccacagacacctggcagc
tccacgccgaaaaatgaagtgcacaagagcacgcaggcgcttcacaacaccaacctgacc
cgggaagtcaggccactctccgcctcgcagccctcgctgccccatgaggtgtccactctg
atttccagacctcatcccactgtgggcgagtccctggcctccatccctcaacccgtgacg
gcggtccccggaacgggccttcaggcagggggcaggagcactgtcccgcagcgcgtcacc
ctcttccgacagatgtcgtcgggagccatccccccgaaccgaggagtccctccagcaccc
cctccaccagcagctgctcttccaagagaatcttcctcagtcttaaacacagacccagac
gcagaaaagccacgatttgcttcaaatttatga

DBGET integrated database retrieval system