KEGG   Homo sapiens (human): 349565Help
Entry
349565            CDS       T01001                                 

Gene name
NMNAT3, PNAT-3, PNAT3
Definition
nicotinamide nucleotide adenylyltransferase 3 (EC:2.7.7.1 2.7.7.18)
Orthology
K06210  
nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    349565 (NMNAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     349565 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     349565 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q23
AA seq 163 aa AA seqDB search
MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTAVPELKLLCGADVLKTFQTPNLWK
DAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRAL
GQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccgaatacctgtggtgctcctggcctgtggctcctttaaccccatcaccaac
atgcacctgcgcatgtttgaggtggccagagatcacctacaccaaacagctgtgcctgag
ctgaagcttctctgtggggcagacgtcttgaagaccttccagacccccaacctctggaag
gatgcgcacatccaggaaatagtggagaagtttggcttggtgtgcgtgggccgagtaggt
cacgacccaaaaggttacatcgcagaatctcccatcctacggatgcaccagcacaacatt
cacctggccaaggagcctgtgcagaatgagatcagtgccacatacatcaggcgagccttg
ggccaagggcagagcgtaaagtacctgattcccgatgctgtcatcacgtacatcaaggac
catggcctctacaccaagggcagtacctggaaaggcaaaagcacccagagcactgagggc
aagacaagctag

DBGET integrated database retrieval system