KEGG   Homo sapiens (human): 35Help
Entry
35                CDS       T01001                                 

Gene name
ACADS, ACAD3, SCAD
Definition
acyl-CoA dehydrogenase, C-2 to C-3 short chain (EC:1.3.8.1)
Orthology
K00248  
butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Disease
H00525  
Disorders of fatty-acid oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    35 (ACADS)
   01212 Fatty acid metabolism
    35 (ACADS)
  Carbohydrate metabolism
   00650 Butanoate metabolism
    35 (ACADS)
  Lipid metabolism
   00071 Fatty acid degradation
    35 (ACADS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    35 (ACADS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     35 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 412 aa AA seqDB search
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgctgctcgcccgggcctcgggccctgcccgcagagctctctgtcctagg
gcctggcggcagttacacaccatctaccagtctgtggaactgcccgagacacaccagatg
ttgctccagacatgccgggactttgccgagaaggagttgtttcccattgcagcccaggtg
gataaggaacatctcttcccagcggctcaggtgaagaagatgggcgggcttgggcttctg
gccatggacgtgcccgaggagcttggcggtgctggcctcgattacctggcctacgccatc
gccatggaggagatcagccgtggctgcgcctccaccggagtcatcatgagtgtcaacaac
tctctctacctggggcccatcttgaagtttggctccaaggagcagaagcaggcgtgggtc
acgcctttcaccagtggtgacaaaattggctgctttgccctcagcgaaccagggaacggc
agtgatgcaggagctgcgtccaccaccgcccgggccgagggcgactcatgggttctgaat
ggaaccaaagcctggatcaccaatgcctgggaggcttcggctgccgtggtctttgccagc
acggacagagccctgcaaaacaagggcatcagtgccttcctggtccccatgccaacgcct
gggctcacgttggggaagaaagaagacaagctgggcatccggggctcatccacggccaac
ctcatctttgaggactgtcgcatccccaaggacagcatcctgggggagccagggatgggc
ttcaagatagccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcattgcccagaccgccctcgattgtgctgtgaactacgctgagaatcgcatggccttc
ggggcgcccctcaccaagctccaggtcatccagttcaagttggcagacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggataacaagaagcct
ttcatcaaggaggcagccatggccaagctggccgcctcggaggccgcgaccgccatcagc
caccaggccatccagatcctgggcggcatgggctacgtgacagagatgccggcagagcgg
cactaccgcgacgcccgcatcactgagatctacgagggcaccagcgaaatccagcggctg
gtgatcgccgggcatctgctcaggagctaccggagctga

DBGET integrated database retrieval system