KEGG   Homo sapiens (human): 35Help
Entry
35                CDS       T01001                                 

Gene name
ACADS, ACAD3, SCAD
Definition
(RefSeq) acyl-CoA dehydrogenase, C-2 to C-3 short chain
  KO
K00248  
butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Disease
H00525  
Disorders of fatty-acid oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    35 (ACADS)
  Lipid metabolism
   00071 Fatty acid degradation
    35 (ACADS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    35 (ACADS)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     35 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P16219(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 412 aa AA seqDB search
MAAALLARASGPARRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgctgctcgcccgggcctcgggccctgcccgcagagctctctgtcctagg
gcctggcggcagttacacaccatctaccagtctgtggaactgcccgagacacaccagatg
ttgctccagacatgccgggactttgccgagaaggagttgtttcccattgcagcccaggtg
gataaggaacatctcttcccagcggctcaggtgaagaagatgggcgggcttgggcttctg
gccatggacgtgcccgaggagcttggcggtgctggcctcgattacctggcctacgccatc
gccatggaggagatcagccgtggctgcgcctccaccggagtcatcatgagtgtcaacaac
tctctctacctggggcccatcttgaagtttggctccaaggagcagaagcaggcgtgggtc
acgcctttcaccagtggtgacaaaattggctgctttgccctcagcgaaccagggaacggc
agtgatgcaggagctgcgtccaccaccgcccgggccgagggcgactcatgggttctgaat
ggaaccaaagcctggatcaccaatgcctgggaggcttcggctgccgtggtctttgccagc
acggacagagccctgcaaaacaagggcatcagtgccttcctggtccccatgccaacgcct
gggctcacgttggggaagaaagaagacaagctgggcatccggggctcatccacggccaac
ctcatctttgaggactgtcgcatccccaaggacagcatcctgggggagccagggatgggc
ttcaagatagccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcattgcccagaccgccctcgattgtgctgtgaactacgctgagaatcgcatggccttc
ggggcgcccctcaccaagctccaggtcatccagttcaagttggcagacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggataacaagaagcct
ttcatcaaggaggcagccatggccaagctggccgcctcggaggccgcgaccgccatcagc
caccaggccatccagatcctgggcggcatgggctacgtgacagagatgccggcagagcgg
cactaccgcgacgcccgcatcactgagatctacgagggcaccagcgaaatccagcggctg
gtgatcgccgggcatctgctcaggagctaccggagctga

DBGET integrated database retrieval system