KEGG   Homo sapiens (human): 3516Help
Entry
3516              CDS       T01001                                 

Gene name
RBPJ, AOS3, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBPJK, RBPSUH, SUH, csl
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region
  KO
K06053  
recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Th1 and Th2 cell differentiation
Epstein-Barr virus infection
Viral carcinogenesis
Module
Notch signaling
Disease
H01413  
Adams-Oliver syndrome (AOS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    3516 (RBPJ)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    3516 (RBPJ)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    3516 (RBPJ)
  Infectious diseases
   05169 Epstein-Barr virus infection
    3516 (RBPJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.2
AA seq 500 aa AA seqDB search
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaccacacggagggctcgcccgcggaggagccgcctgcgcatgctccatcgcctggg
aaatttggtgagcggcctccacctaaacgacttactagggaagctatgcgaaattattta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggtttttttgcccacctccttgtgtatatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgcgatggttgttctgaacaagagtctcaaccgtgt
gcatttattgggataggaaatagtgaccaagaaatgcagcagctaaacttggaaggaaag
aactattgcacagccaaaacattgtatatatctgactcagacaagcgaaagcacttcatg
ttgtctgtaaagatgttctatggcaacagtgatgacattggtgtgttcctcagcaagcgg
ataaaagtcatctccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttatgc
attgcctcaggaacaaaggtggctctgtttaatcgactacgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaattttcatgccagttcacagcagtggggagccttt
tttattcatctcttggatgatgatgaatcagaaggagaagaattcacagtccgagatggc
tacatccattatggacaaacagtcaaacttgtgtgctcagttactggcatggcactccca
agattgataattaggaaagttgataagcagaccgcattattggatgcagatgatcctgtg
tcacaactccataaatgtgcattttaccttaaggatacagaaagaatgtatttgtgcctt
tctcaagaaagaataattcaatttcaggccactccatgtccaaaagaaccaaataaagag
atgataaatgatggcgcttcctggacaatcattagcacagataaggcagagtatacattt
tatgagggaatgggccctgtccttgccccagtcactcctgtgcctgtggtagagagcctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacaggtgtggagagagt
atgctctgtgtcgtcccagacatttctgcattccgagaaggttggagatgggtccggcaa
ccagtccaggttccagtaactttggtccgaaatgatggaatcatttattccaccagcctt
acctttacctacacaccagaaccagggccgcggccacattgcagtgcagcaggagcaatc
cttcgagccaattcaagccaggtgccccctaacgaatcaaacacaaacagcgagggaagt
tacacaaacgccagcacaaattcaaccagtgtcacatcatctacagccacagtggtatcc
taa

DBGET integrated database retrieval system