KEGG   Homo sapiens (human): 3516Help
Entry
3516              CDS       T01001                                 

Gene name
RBPJ, AOS3, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBPJK, RBPSUH, SUH, csl
Definition
recombination signal binding protein for immunoglobulin kappa J region
Orthology
K06053  
recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.2
AA seq 500 aa AA seqDB search
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaccacacggagggctcgcccgcggaggagccgcctgcgcatgctccatcgcctggg
aaatttggtgagcggcctccacctaaacgacttactagggaagctatgcgaaattattta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggtttttttgcccacctccttgtgtatatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgcgatggttgttctgaacaagagtctcaaccgtgt
gcatttattgggataggaaatagtgaccaagaaatgcagcagctaaacttggaaggaaag
aactattgcacagccaaaacattgtatatatctgactcagacaagcgaaagcacttcatg
ttgtctgtaaagatgttctatggcaacagtgatgacattggtgtgttcctcagcaagcgg
ataaaagtcatctccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttatgc
attgcctcaggaacaaaggtggctctgtttaatcgactacgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaattttcatgccagttcacagcagtggggagccttt
tttattcatctcttggatgatgatgaatcagaaggagaagaattcacagtccgagatggc
tacatccattatggacaaacagtcaaacttgtgtgctcagttactggcatggcactccca
agattgataattaggaaagttgataagcagaccgcattattggatgcagatgatcctgtg
tcacaactccataaatgtgcattttaccttaaggatacagaaagaatgtatttgtgcctt
tctcaagaaagaataattcaatttcaggccactccatgtccaaaagaaccaaataaagag
atgataaatgatggcgcttcctggacaatcattagcacagataaggcagagtatacattt
tatgagggaatgggccctgtccttgccccagtcactcctgtgcctgtggtagagagcctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacaggtgtggagagagt
atgctctgtgtcgtcccagacatttctgcattccgagaaggttggagatgggtccggcaa
ccagtccaggttccagtaactttggtccgaaatgatggaatcatttattccaccagcctt
acctttacctacacaccagaaccagggccgcggccacattgcagtgcagcaggagcaatc
cttcgagccaattcaagccaggtgccccctaacgaatcaaacacaaacagcgagggaagt
tacacaaacgccagcacaaattcaaccagtgtcacatcatctacagccacagtggtatcc
taa

DBGET integrated database retrieval system