KEGG   Homo sapiens (human): 353376Help
Entry
353376            CDS       T01001                                 

Gene name
TICAM2, MyD88-4, TICAM-2, TIRAP3, TIRP, TRAM
Definition
toll-like receptor adaptor molecule 2
Orthology
K05409  
TRIF-related adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pertussis
Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    353376 (TICAM2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    353376 (TICAM2)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    353376 (TICAM2)
   05161 Hepatitis B
    353376 (TICAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23.1
AA seq 235 aa AA seqDB search
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgggaagtctaaaataaattcctgccctctttctctctcttggggtaaaagg
cacagtgtggatacaagtccaggatatcatgagtcagattccaagaagtctgaagatcta
tccttgtgtaatgttgctgagcacagcaatacaacagaggggccaacaggaaagcaggag
ggagctcagagcgtggaagagatgtttgaagaagaagctgaagaagaggtgttcctcaaa
tttgtgatattgcatgcagaagatgacacagatgaagccctcagagtccagaatctgcta
caagatgactttggtatcaaacccggaataatctttgctgagatgccatgtggcagacag
catttacagaatttagatgatgctgtaaatgggtctgcatggacaatcttattactgact
gaaaactttttaagagatacttggtgtaatttccagttctatacgtccctaatgaactcc
gttaacaggcagcataaatacaactctgttatacccatgcggcccctgaacaatcccctt
ccccgagaaaggactccctttgccctccaaaccatcaatgccttagaggaagaaagtcgt
ggatttcctacacaagtagaaagaatttttcaggagtctgtgtataagacacaacaaact
atatggaaagagacaagaaatatggtacaaagacaatttattgcctga

DBGET integrated database retrieval system