KEGG   Homo sapiens (human): 353376Help
Entry
353376            CDS       T01001                                 

Gene name
TICAM2, MyD88-4, TICAM-2, TIRAP3, TIRP, TRAM
Definition
toll-like receptor adaptor molecule 2
Orthology
K05409  
TRIF-related adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pertussis
Hepatitis B
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23.1
AA seq 235 aa AA seqDB search
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgggaagtctaaaataaattcctgccctctttctctctcttggggtaaaagg
cacagtgtggatacaagtccaggatatcatgagtcagattccaagaagtctgaagatcta
tccttgtgtaatgttgctgagcacagcaatacaacagaggggccaacaggaaagcaggag
ggagctcagagcgtggaagagatgtttgaagaagaagctgaagaagaggtgttcctcaaa
tttgtgatattgcatgcagaagatgacacagatgaagccctcagagtccagaatctgcta
caagatgactttggtatcaaacccggaataatctttgctgagatgccatgtggcagacag
catttacagaatttagatgatgctgtaaatgggtctgcatggacaatcttattactgact
gaaaactttttaagagatacttggtgtaatttccagttctatacgtccctaatgaactcc
gttaacaggcagcataaatacaactctgttatacccatgcggcccctgaacaatcccctt
ccccgagaaaggactccctttgccctccaaaccatcaatgccttagaggaagaaagtcgt
ggatttcctacacaagtagaaagaatttttcaggagtctgtgtataagacacaacaaact
atatggaaagagacaagaaatatggtacaaagacaatttattgcctga

DBGET integrated database retrieval system