KEGG   Homo sapiens (human): 353376Help
Entry
353376            CDS       T01001                                 

Gene name
TICAM2, MyD88-4, TICAM-2, TIRAP3, TIRP, TRAM
Definition
(RefSeq) toll like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa05133  Pertussis
hsa05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    353376 (TICAM2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    353376 (TICAM2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    353376 (TICAM2)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    353376 (TICAM2)
   05161 Hepatitis B
    353376 (TICAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 353376
NCBI-ProteinID: NP_067681
OMIM: 608321
HGNC: 21354
Ensembl: ENSG00000243414
Vega: OTTHUMG00000162905
Pharos: Q86XR7(Tbio)
UniProt: Q86XR7
Structure
PDB: 

Jmol
Position
5q22.3
AA seq 235 aa AA seqDB search
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgggaagtctaaaataaattcctgccctctttctctctcttggggtaaaagg
cacagtgtggatacaagtccaggatatcatgagtcagattccaagaagtctgaagatcta
tccttgtgtaatgttgctgagcacagcaatacaacagaggggccaacaggaaagcaggag
ggagctcagagcgtggaagagatgtttgaagaagaagctgaagaagaggtgttcctcaaa
tttgtgatattgcatgcagaagatgacacagatgaagccctcagagtccagaatctgcta
caagatgactttggtatcaaacccggaataatctttgctgagatgccatgtggcagacag
catttacagaatttagatgatgctgtaaatgggtctgcatggacaatcttattactgact
gaaaactttttaagagatacttggtgtaatttccagttctatacgtccctaatgaactcc
gttaacaggcagcataaatacaactctgttatacccatgcggcccctgaacaatcccctt
ccccgagaaaggactccctttgccctccaaaccatcaatgccttagaggaagaaagtcgt
ggatttcctacacaagtagaaagaatttttcaggagtctgtgtataagacacaacaaact
atatggaaagagacaagaaatatggtacaaagacaatttattgcctga

DBGET integrated database retrieval system