KEGG   Homo sapiens (human): 354Help
Entry
354               CDS       T01001                                 

Gene name
KLK3, APS, KLK2A1, PSA, hK3
Definition
kallikrein-related peptidase 3 (EC:3.4.21.77)
Orthology
K01351  
semenogelase [EC:3.4.21.77]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Prostate cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.41
AA seq 238 aa AA seqDB search
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSWVILITELTMPALPMVLHGSLVPWRGGV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtcccggttgtcttcctcaccctgtccgtgacgtggattggtgctgcacccctc
atcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtg
cttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtc
ctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcctg
tttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctc
tacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgac
ctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggac
ctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcatt
gaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttcc
aatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctgga
cgctggacagggggcaaaagcacctgctcgtgggtcattctgatcaccgaactgaccatg
ccagccctgccgatggtcctccatggctccctagtgccctggagaggaggtgtctag

DBGET integrated database retrieval system